PDB entry 4djr

View 4djr on RCSB PDB site
Description: Crystal Structure of wild-type HIV-1 Protease in Complex with MKP97
Class: HYDROLASE/HYDROLASE inhibitor
Keywords: HIV-1 protease, drug resistance, drug design, Protease inhibitors, AIDS, Aspartyl protease, HYDROLASE-HYDROLASE inhibitor complex
Deposited on 2012-02-02, released 2012-08-01
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-01-02, with a file datestamp of 2012-12-28.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.172
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Pol polyprotein
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: Gag-Pol, pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q90K99 (0-98)
    • engineered mutation (6)
  Domains in SCOPe 2.05: d4djra_
• Chain 'B':
  Compound: Pol polyprotein
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: Gag-Pol, pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q90K99 (0-98)
    • engineered mutation (6)
  Domains in SCOPe 2.05: d4djrb_
• Heterogens: 0KJ, PO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4djrA (A:)
  pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
  qipieicghkaigtvlvgptpvniigrnlltqigctlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4djrB (B:)
  pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
  qipieicghkaigtvlvgptpvniigrnlltqigctlnf