PDB entry 4djq

View 4djq on RCSB PDB site
Description: Crystal Structure of wild-type HIV-1 Protease in Complex with MKP86
Class: HYDROLASE/HYDROLASE inhibitor
Keywords: HIV-1 protease, drug resistance, drug design, Protease inhibitors, AIDS, Aspartyl protease, HYDROLASE-HYDROLASE inhibitor complex
Deposited on 2012-02-02, released 2012-08-01
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-01-02, with a file datestamp of 2012-12-28.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.18
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pol polyprotein
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: Gag-Pol, pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q90K99 (0-98)
      • engineered mutation (6)
    Domains in SCOPe 2.04: d4djqa_
  • Chain 'B':
    Compound: Pol polyprotein
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: Gag-Pol, pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q90K99 (0-98)
      • engineered mutation (6)
    Domains in SCOPe 2.04: d4djqb_
  • Heterogens: M86, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4djqA (A:)
    pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
    qipieicghkaigtvlvgptpvniigrnlltqigctlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4djqB (B:)
    pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
    qipieicghkaigtvlvgptpvniigrnlltqigctlnf