PDB entry 4djd

View 4djd on RCSB PDB site
Description: Crystal structure of folate-free corrinoid iron-sulfur protein (CFeSP) in complex with its methyltransferase (MeTr)
Class: transferase/vitamin-binding protein
Keywords: TIM barrel, Rossmann fold, B12-dependent methyltransferase, TRANSFERASE-VITAMIN-BINDING PROTEIN complex
Deposited on 2012-02-01, released 2012-03-14
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-10-24, with a file datestamp of 2012-10-19.
Experiment type: XRAY
Resolution: 2.38 Å
R-factor: 0.189
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: 5-methyltetrahydrofolate corrinoid/iron sulfur protein methyltransferase
  Species: Moorella thermoacetica [TaxId:1525]
  Gene: acsE
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q46389 (0-261)
  Domains in SCOPe 2.04: d4djda_
• Chain 'B':
  Compound: 5-methyltetrahydrofolate corrinoid/iron sulfur protein methyltransferase
  Species: Moorella thermoacetica [TaxId:1525]
  Gene: acsE
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q46389 (0-261)
  Domains in SCOPe 2.04: d4djdb_
• Chain 'C':
  Compound: Corrinoid/iron-sulfur protein large subunit
  Species: Moorella thermoacetica [TaxId:1525]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q07340
• Chain 'D':
  Compound: Corrinoid/iron-sulfur protein small subunit
  Species: Moorella thermoacetica [TaxId:1525]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q07341 (0-322)
• Chain 'E':
  Compound: Corrinoid/iron-sulfur protein large subunit
  Species: Moorella thermoacetica [TaxId:1525]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q07340
• Chain 'F':
  Compound: Corrinoid/iron-sulfur protein small subunit
  Species: Moorella thermoacetica [TaxId:1525]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q07341 (0-322)
• Heterogens: CA, SF4, B12, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4djdA (A:)
  mliigeringmfgdikraiqerdpapvqewarrqeeggaraldlnvgpavqdkvsamewl
  vevtqevsnltlcldstnikaieaglkkcknraminstnaerekveklfplavehgaali
  gltmnktgipkdsdtrlafamelvaaadefglpmedlyidplilpanvaqdhapevlktl
  qqikmladpapktvlglsnvsqncqnrplinrtflamamacgldaaiadacdealietaa
  taeillnqtvycdsfvkmfktr
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4djdB (B:)
  mliigeringmfgdikraiqerdpapvqewarrqeeggaraldlnvgpavqdkvsamewl
  vevtqevsnltlcldstnikaieaglkkcknraminstnaerekveklfplavehgaali
  gltmnktgipkdsdtrlafamelvaaadefglpmedlyidplilpanvaqdhapevlktl
  qqikmladpapktvlglsnvsqncqnrplinrtflamamacgldaaiadacdealietaa
  taeillnqtvycdsfvkmfktr
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  No sequence available.