PDB entry 4dj8

View 4dj8 on RCSB PDB site
Description: Structure of the hemagglutinin complexed with 6SLN from a highly pathogenic H7N7 influenza virus
Class: viral protein
Keywords: receptor binding, glycoprotein, VIRAL PROTEIN
Deposited on 2012-02-01, released 2012-06-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Netherlands/219/2003(H7N7)) [TaxId:680693]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4dj8a_
  • Chain 'B':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Netherlands/219/2003(H7N7)) [TaxId:680693]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4dj8b_
  • Chain 'C':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Netherlands/219/2003(H7N7)) [TaxId:680693]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4dj8c_
  • Chain 'D':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Netherlands/219/2003(H7N7)) [TaxId:680693]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4dj8d_
  • Chain 'E':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Netherlands/219/2003(H7N7)) [TaxId:680693]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6VMK1 (4-End)
      • expression tag (3)
    Domains in SCOPe 2.08: d4dj8e1, d4dj8e2
  • Chain 'F':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Netherlands/219/2003(H7N7)) [TaxId:680693]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4dj8f_
  • Heterogens: NAG, SIA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4dj8A (A:)
    adpgdkiclghhavsngtkvntltergvevvnatetvertnvpricskgkrtvdlgqcgl
    lgtitgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidketmgft
    ysgirtngttsacrrsgssfyaemkwllsntdnaafpqmtksykntrkdpaliiwgihhs
    gstteqtklygsgnklitvgssnyqqsfvpspgarpqvngqsgridfhwlilnpndtvtf
    sfngafiapdrasflrgksmgiqsevqvdancegdcyhsggtiisnlpfqninsravgkc
    pryvkqeslllatgmknvpeipkrrrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dj8A (A:)
    dkiclghhavsngtkvntltergvevvnatetvertnvpricskgkrtvdlgqcgllgti
    tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidketmgftysgi
    rtngttsacrrsgssfyaemkwllsntdnaafpqmtksykntrkdpaliiwgihhsgstt
    eqtklygsgnklitvgssnyqqsfvpspgarpqvngqsgridfhwlilnpndtvtfsfng
    afiapdrasflrgksmgiqsevqvdancegdcyhsggtiisnlpfqninsravgkcpryv
    kqeslllatgmknvpe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4dj8B (B:)
    glfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektn
    qqfelidnefteverqignvinwtrdsmtevwsynaellvamenqhtidladsemnklye
    rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeaiqnriqidsgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dj8B (B:)
    glfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektn
    qqfelidnefteverqignvinwtrdsmtevwsynaellvamenqhtidladsemnklye
    rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeaiqnr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4dj8C (C:)
    adpgdkiclghhavsngtkvntltergvevvnatetvertnvpricskgkrtvdlgqcgl
    lgtitgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidketmgft
    ysgirtngttsacrrsgssfyaemkwllsntdnaafpqmtksykntrkdpaliiwgihhs
    gstteqtklygsgnklitvgssnyqqsfvpspgarpqvngqsgridfhwlilnpndtvtf
    sfngafiapdrasflrgksmgiqsevqvdancegdcyhsggtiisnlpfqninsravgkc
    pryvkqeslllatgmknvpeipkrrrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dj8C (C:)
    dkiclghhavsngtkvntltergvevvnatetvertnvpricskgkrtvdlgqcgllgti
    tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidketmgftysgi
    rtngttsacrrsgssfyaemkwllsntdnaafpqmtksykntrkdpaliiwgihhsgstt
    eqtklygsgnklitvgssnyqqsfvpspgarpqvngqsgridfhwlilnpndtvtfsfng
    afiapdrasflrgksmgiqsevqvdancegdcyhsggtiisnlpfqninsravgkcpryv
    kqeslllatgmknvpe
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4dj8D (D:)
    glfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektn
    qqfelidnefteverqignvinwtrdsmtevwsynaellvamenqhtidladsemnklye
    rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeaiqnriqidsgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dj8D (D:)
    glfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektn
    qqfelidnefteverqignvinwtrdsmtevwsynaellvamenqhtidladsemnklye
    rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeaiqnri
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4dj8E (E:)
    adpgdkiclghhavsngtkvntltergvevvnatetvertnvpricskgkrtvdlgqcgl
    lgtitgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidketmgft
    ysgirtngttsacrrsgssfyaemkwllsntdnaafpqmtksykntrkdpaliiwgihhs
    gstteqtklygsgnklitvgssnyqqsfvpspgarpqvngqsgridfhwlilnpndtvtf
    sfngafiapdrasflrgksmgiqsevqvdancegdcyhsggtiisnlpfqninsravgkc
    pryvkqeslllatgmknvpeipkrrrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dj8E (E:)
    gdkiclghhavsngtkvntltergvevvnatetvertnvpricskgkrtvdlgqcgllgt
    itgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidketmgftysg
    irtngttsacrrsgssfyaemkwllsntdnaafpqmtksykntrkdpaliiwgihhsgst
    teqtklygsgnklitvgssnyqqsfvpspgarpqvngqsgridfhwlilnpndtvtfsfn
    gafiapdrasflrgksmgiqsevqvdancegdcyhsggtiisnlpfqninsravgkcpry
    vkqeslllatgmknvpe
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4dj8F (F:)
    glfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektn
    qqfelidnefteverqignvinwtrdsmtevwsynaellvamenqhtidladsemnklye
    rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeaiqnriqidsgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dj8F (F:)
    glfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektn
    qqfelidnefteverqignvinwtrdsmtevwsynaellvamenqhtidladsemnklye
    rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeaiqn