PDB entry 4dj4

View 4dj4 on RCSB PDB site
Description: X-ray structure of mutant N211D of bifunctional nuclease TBN1 from Solanum lycopersicum (Tomato)
Class: hydrolase
Keywords: mainly alpha helical, trinuclear metal centre, bi-functional, nuclease, 3'-nucleotidase, cytosol membrane associated, HYDROLASE
Deposited on 2012-02-01, released 2012-11-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-02-20, with a file datestamp of 2013-02-15.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.186
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nuclease
    Species: Solanum lycopersicum [TaxId:4081]
    Gene: tbn1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0KFV0 (0-End)
      • engineered mutation (185)
    Domains in SCOPe 2.06: d4dj4a_
  • Chain 'B':
    Compound: Nuclease
    Species: Solanum lycopersicum [TaxId:4081]
    Gene: tbn1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0KFV0 (0-End)
      • engineered mutation (185)
    Domains in SCOPe 2.06: d4dj4b_
  • Heterogens: ZN, CL, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4dj4A (A:)
    wskeghvmtcriaqgllndeaahavkmllpeyvngdlsalcvwpdqvrhwykykwtsplh
    fidtpdkacnfdyerdchdqhgvkdmcvagaiqnfttqlshyregtsdrrynmteallfl
    shfmgdihqpmhvgftsdaggnsidlrwfrhksnlhhvwdreiiltaakdyyakdinlle
    ediegdftdgiwsddlaswrecgnvfscvnkfatesiniackwgykgveagetlsddyfn
    srlpivmkrvaqggirlamllnnvfgasqqedsvvat
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dj4A (A:)
    wskeghvmtcriaqgllndeaahavkmllpeyvngdlsalcvwpdqvrhwykykwtsplh
    fidtpdkacnfdyerdchdqhgvkdmcvagaiqnfttqlshyregtsdrrynmteallfl
    shfmgdihqpmhvgftsdaggnsidlrwfrhksnlhhvwdreiiltaakdyyakdinlle
    ediegdftdgiwsddlaswrecgnvfscvnkfatesiniackwgykgveagetlsddyfn
    srlpivmkrvaqggirlamllnnvfg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4dj4B (B:)
    wskeghvmtcriaqgllndeaahavkmllpeyvngdlsalcvwpdqvrhwykykwtsplh
    fidtpdkacnfdyerdchdqhgvkdmcvagaiqnfttqlshyregtsdrrynmteallfl
    shfmgdihqpmhvgftsdaggnsidlrwfrhksnlhhvwdreiiltaakdyyakdinlle
    ediegdftdgiwsddlaswrecgnvfscvnkfatesiniackwgykgveagetlsddyfn
    srlpivmkrvaqggirlamllnnvfgasqqedsvvat
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dj4B (B:)
    wskeghvmtcriaqgllndeaahavkmllpeyvngdlsalcvwpdqvrhwykykwtsplh
    fidtpdkacnfdyerdchdqhgvkdmcvagaiqnfttqlshyregtynmteallflshfm
    gdihqpmhvgftsdaggnsidlrwfrhksnlhhvwdreiiltaakdyyakdinlleedie
    gdftdgecgnvfscvnkfatesiniackwgykgveagetlsddyfnsrlpivmkrvaqgg
    irlamllnnvf