PDB entry 4di0

View 4di0 on RCSB PDB site
Description: The structure of Rubrerythrin from Burkholderia pseudomallei
Class: oxidoreductase
Keywords: SSGCID, seattle structural genomics center for infectious disease, peroxidase, OXIDOREDUCTASE
Deposited on 2012-01-30, released 2012-02-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-02-08, with a file datestamp of 2012-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.171
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rubrerythrin
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: BURPS1710b_A0924
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4di0a_
  • Chain 'B':
    Compound: rubrerythrin
    Species: Burkholderia pseudomallei [TaxId:320372]
    Gene: BURPS1710b_A0924
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4di0b_
  • Heterogens: FE, EDO, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4di0A (A:)
    gpgsmaqlkgskteenlkyafagesqanrrylyfaskadvegqndiaalfrstaegetgh
    ahghleyleavgdpatglpfgtsrqnlqsaiagetheytdmypgmaktardegfeeianw
    fetlakaershanrytkaldglvd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4di0A (A:)
    aqlkgskteenlkyafagesqanrrylyfaskadvegqndiaalfrstaegetghahghl
    eyleavgdpatglpfgtsrqnlqsaiagetheytdmypgmaktardegfeeianwfetla
    kaershanrytkaldglvd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4di0B (B:)
    gpgsmaqlkgskteenlkyafagesqanrrylyfaskadvegqndiaalfrstaegetgh
    ahghleyleavgdpatglpfgtsrqnlqsaiagetheytdmypgmaktardegfeeianw
    fetlakaershanrytkaldglvd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4di0B (B:)
    maqlkgskteenlkyafagesqanrrylyfaskadvegqndiaalfrstaegetghahgh
    leyleavgdpatglpfgtsrqnlqsaiagetheytdmypgmaktardegfeeianwfetl
    akaershanrytkaldglvd