PDB entry 4dhl

View 4dhl on RCSB PDB site
Description: Crystal structure of red kidney bean purple acid phosphatase in complex with Maybridge fragment MO07123
Class: hydrolase
Keywords: Catalytic C domain, N terminal domain, Phosphatase, Acid Phosphatase, Phosphoric Monoester Hydrolases, Hydrolase, MO07123, Maybridge, Fragment, lysosome
Deposited on 2012-01-29, released 2012-12-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-01-02, with a file datestamp of 2012-12-28.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.16
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: purple acid phosphatase
    Species: Phaseolus vulgaris [TaxId:3885]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4dhla1, d4dhla2
  • Chain 'B':
    Compound: purple acid phosphatase
    Species: Phaseolus vulgaris [TaxId:3885]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4dhlb1, d4dhlb2
  • Chain 'C':
    Compound: purple acid phosphatase
    Species: Phaseolus vulgaris [TaxId:3885]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4dhlc1, d4dhlc2
  • Chain 'D':
    Compound: purple acid phosphatase
    Species: Phaseolus vulgaris [TaxId:3885]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4dhld1, d4dhld2
  • Heterogens: ZN, FE, 0K7, GOL, SO4, EDO, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4dhlA (A:)
    knrdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngr
    kriakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitppqtgldv
    pytfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwdtwgrft
    ersvayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysikrasah
    iivlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmegeamrtk
    feawfvkykvdvvfaghvhayerservsniaykitnglctpvkdqsapvyitigdagnyg
    vidsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwffnrhwy
    pvddst
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dhlA (A:)
    nrdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngrk
    riakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitppqtgldvp
    ytfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwdtwgrfte
    rsvayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysikrasahi
    ivlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmegeamrtkf
    eawfvkykvdvvfaghvhayerservsniaykitnglctpvkdqsapvyitigdagnygv
    idsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwffnrhwyp
    vdds
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4dhlB (B:)
    knrdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngr
    kriakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitppqtgldv
    pytfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwdtwgrft
    ersvayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysikrasah
    iivlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmegeamrtk
    feawfvkykvdvvfaghvhayerservsniaykitnglctpvkdqsapvyitigdagnyg
    vidsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwffnrhwy
    pvddst
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dhlB (B:)
    nrdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngrk
    riakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitppqtgldvp
    ytfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwdtwgrfte
    rsvayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysikrasahi
    ivlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmegeamrtkf
    eawfvkykvdvvfaghvhayerservsniaykitnglctpvkdqsapvyitigdagnygv
    idsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwffnrhwyp
    vddst
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4dhlC (C:)
    knrdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngr
    kriakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitppqtgldv
    pytfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwdtwgrft
    ersvayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysikrasah
    iivlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmegeamrtk
    feawfvkykvdvvfaghvhayerservsniaykitnglctpvkdqsapvyitigdagnyg
    vidsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwffnrhwy
    pvddst
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dhlC (C:)
    knrdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngr
    kriakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitppqtgldv
    pytfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwdtwgrft
    ersvayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysikrasah
    iivlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmegeamrtk
    feawfvkykvdvvfaghvhayerservsniaykitnglctpvkdqsapvyitigdagnyg
    vidsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwffnrhwy
    pvdd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4dhlD (D:)
    knrdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngr
    kriakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitppqtgldv
    pytfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwdtwgrft
    ersvayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysikrasah
    iivlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmegeamrtk
    feawfvkykvdvvfaghvhayerservsniaykitnglctpvkdqsapvyitigdagnyg
    vidsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwffnrhwy
    pvddst
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dhlD (D:)
    nrdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngrk
    riakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitppqtgldvp
    ytfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwdtwgrfte
    rsvayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysikrasahi
    ivlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmegeamrtkf
    eawfvkykvdvvfaghvhayerservsniaykitnglctpvkdqsapvyitigdagnygv
    idsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwffnrhwyp
    vdd