PDB entry 4dhj

View 4dhj on RCSB PDB site
Description: The structure of a ceOTUB1 ubiquitin aldehyde UBC13~Ub complex
Class: hydrolase/signaling protein/ligase
Keywords: ubiquitination, HYDROLASE-SIGNALING PROTEIN-LIGASE complex
Deposited on 2012-01-27, released 2012-02-22
The last revision prior to the SCOPe 2.02 freeze date was dated 2012-04-04, with a file datestamp of 2012-03-30.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.204
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Ubiquitin thioesterase otubain-like
  Species: Caenorhabditis elegans [TaxId:6239]
  Gene: otub-1, C25D7.8
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9XVR6
• Chain 'B':
  Compound: Ubiquitin aldehyde
  Species: Homo sapiens [TaxId:9606]
  Gene: UBC
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0CG48 (0-75)
• Chain 'C':
  Compound: Ubiquitin-conjugating enzyme E2 N
  Species: Homo sapiens [TaxId:9606]
  Gene: UBE2N, BLU
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61088
• Chain 'D':
  Compound: Ubiquitin
  Species: Homo sapiens [TaxId:9606]
  Gene: UBC
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0CG48 (0-End)
• Chain 'E':
  Compound: Ubiquitin thioesterase otubain-like
  Species: Caenorhabditis elegans [TaxId:6239]
  Gene: otub-1, C25D7.8
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9XVR6
• Chain 'F':
  Compound: Ubiquitin aldehyde
  Species: Homo sapiens [TaxId:9606]
  Gene: UBC
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0CG48 (0-75)
• Chain 'G':
  Compound: Ubiquitin-conjugating enzyme E2 N
  Species: Homo sapiens [TaxId:9606]
  Gene: UBE2N, BLU
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61088
• Chain 'H':
  Compound: Ubiquitin
  Species: Homo sapiens [TaxId:9606]
  Gene: UBC
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0CG48 (0-End)
• Chain 'I':
  Compound: Ubiquitin thioesterase otubain-like
  Species: Caenorhabditis elegans [TaxId:6239]
  Gene: otub-1, C25D7.8
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9XVR6
• Chain 'J':
  Compound: Ubiquitin aldehyde
  Species: Homo sapiens [TaxId:9606]
  Gene: UBC
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0CG48 (0-75)
• Chain 'K':
  Compound: Ubiquitin-conjugating enzyme E2 N
  Species: Homo sapiens [TaxId:9606]
  Gene: UBE2N, BLU
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61088
  Domains in SCOPe 2.02: d4dhjk_
• Chain 'L':
  Compound: Ubiquitin thioesterase otubain-like
  Species: Caenorhabditis elegans [TaxId:6239]
  Gene: otub-1, C25D7.8
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9XVR6
• Chain 'M':
  Compound: Ubiquitin aldehyde
  Species: Homo sapiens [TaxId:9606]
  Gene: UBC
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0CG48 (0-75)
• Chain 'N':
  Compound: Ubiquitin-conjugating enzyme E2 N
  Species: Homo sapiens [TaxId:9606]
  Gene: UBE2N, BLU
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61088
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  No sequence available.
  
  
• Chain 'G':
  No sequence available.
  
  
• Chain 'H':
  No sequence available.
  
  
• Chain 'I':
  No sequence available.
  
  
• Chain 'J':
  No sequence available.
  
  
• Chain 'K':
  Sequence, based on SEQRES records: (download)
  

  >4dhjK (K:)
  maglprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpe
  eypmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpddp
  landvaeqwktneaqaietarawtrlyamnni
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >4dhjK (K:)
  glprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpeey
  pmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpddpla
  ndvaeqwktneaqaietarawtrlyamn
  

  
  
• Chain 'L':
  No sequence available.
  
  
• Chain 'M':
  No sequence available.
  
  
• Chain 'N':
  No sequence available.