PDB entry 4dhi

View 4dhi on RCSB PDB site
Description: Structure of C. elegans OTUB1 bound to human UBC13
Class: hydrolase/ligase
Keywords: ubiquitin E2 enzyme fold, ubiquitination, HYDROLASE-LIGASE complex
Deposited on 2012-01-27, released 2012-02-22
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-04-04, with a file datestamp of 2012-03-30.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.188
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: Ubiquitin thioesterase otubain-like
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: otub-1, C25D7.8
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Ubiquitin-conjugating enzyme E2 N
    Species: Homo sapiens [TaxId:9606]
    Gene: UBE2N, BLU
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4dhid_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'B':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4dhiD (D:)
    maglprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpe
    eypmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpddp
    landvaeqwktneaqaietarawtrlyamnni
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dhiD (D:)
    glprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpeey
    pmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpddpla
    ndvaeqwktneaqaietarawtrlyamnni