PDB entry 4dh0

View 4dh0 on RCSB PDB site
Description: X-ray Crystal Structure of 28-O-Methylrapamycin complexed with FKBP12: Is the Cyclohexyl Moiety Part of the Effector Domain of Rapamycin?
Class: isomerase/immunosuppressant
Keywords: peptidyl-prolyl cis-trans isomerase, ISOMERASE-IMMUNOSUPPRESSANT complex
Deposited on 2012-01-27, released 2012-02-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-04-18, with a file datestamp of 2018-04-13.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Peptidyl-prolyl cis-trans isomerase FKBP1A
  Species: Homo sapiens [TaxId:9606]
  Gene: FKBP1A, FKBP1, FKBP12
  Database cross-references and differences (RAF-indexed):
  • Uniprot P62942 (0-106)
  Domains in SCOPe 2.08: d4dh0a_
• Heterogens: MR8, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4dh0A (A:)
  gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwe
  egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle