PDB entry 4dgx

View 4dgx on RCSB PDB site
Description: LEOPARD Syndrome-Associated SHP2/Y279C mutant
Class: hydrolase
Keywords: hydrolase
Deposited on 2012-01-27, released 2013-03-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-05-01, with a file datestamp of 2013-04-26.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.212
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein phosphatase non-receptor type 11
    Species: Homo sapiens [TaxId:9606]
    Gene: PTPN11, PTP2C, SHPTP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q06124 (Start-527)
      • engineered mutation (278)
    Domains in SCOPe 2.07: d4dgxa1, d4dgxa2, d4dgxa3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4dgxA (A:)
    mtsrrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqntg
    dyydlyggekfatlaelvqyymehhgqlkekngdvielkyplncadptserwfhghlsgk
    eaeklltekgkhgsflvresqshpgdfvlsvrtgddkgesndgkskvthvmircqelkyd
    vgggerfdsltdlvehykknpmvetlgtvlqlkqplnttrinaaeiesrvrelsklaett
    dkvkqgfweefetlqqqeckllysrkegqrqenknknrcknilpfdhtrvvlhdgdpnep
    vsdyinaniimpefetkcnnskpkksyiatqgclqntvndfwrmvfqensrvivmttkev
    ergkskcvkywpdeyalkeygvmrvrnvkesaahdytlrelklskvgqgntertvwqyhf
    rtwpdhgvpsdpggvldfleevhhkqesimdagpvvvhcsagigrtgtfividilidiir
    ekgvdcdidvpktiqmvrsqrsgmvqteaqyrfiymavqhyietlqrrlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dgxA (A:)
    srrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqntgdy
    ydlyggekfatlaelvqyymehhgqlkekngdvielkyplncadptserwfhghlsgkea
    eklltekgkhgsflvresqshpgdfvlsvrtgddkgesndgkskvthvmircqelkydvg
    ggerfdsltdlvehykknpmvetlgtvlqlkqplnttrinaaeiesrvrelskgfweefe
    tlqqqeckllysrkegqrqenknknrcknilpfdhtrvvlhdpvsdyinaniimpekksy
    iatqgclqntvndfwrmvfqensrvivmttkevergkskcvkywpdeyalkeygvmrvrn
    vkesaahdytlrelklskvgqgntertvwqyhfrtwpdhgvpsdpggvldfleevhhkqe
    simdagpvvvhcsagigrtgtfividilidiirekgvdcdidvpktiqmvrsqrsgmvqt
    eaqyrfiymavqhyietlqrr