PDB entry 4dgm

View 4dgm on RCSB PDB site
Description: Crystal Structure of maize CK2 in complex with the inhibitor apigenin
Class: transferase/transferase inhibitor
Keywords: protein kinase, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2012-01-26, released 2012-08-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-01-02, with a file datestamp of 2012-12-28.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.213
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Casein kinase II subunit alpha
    Species: Zea mays [TaxId:4577]
    Gene: ACK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28523 (0-325)
      • conflict (82)
    Domains in SCOPe 2.06: d4dgma_
  • Heterogens: EDO, PEG, AGI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4dgmA (A:)
    skarvyadvnvlrpkeywdyealtvqwgeqddyevvrkvgrgkysevfeginvnnnekci
    ikilkpvkkkkikreikilqnlmggpnivklldivrdqhsktpslifeyvnntdfkvlyp
    tltdydiryyiyellkaldychsqgimhrdvkphnvmidhelrklrlidwglaefyhpgk
    eynvrvasryfkgpellvdlqdydysldmwslgcmfagmifrkepffyghdnhdqlvkia
    kvlgtdglnvylnkyrieldpqlealvgrhsrkpwlkfmnadnqhlvspeaidfldkllr
    ydhqerltaleamthpyfqqvraaen