PDB entry 4dfl

View 4dfl on RCSB PDB site
Description: Crystal structure of spleen tyrosine kinase complexed with a sulfonamidopyrazine piperidine inhibitor
Class: transferase/transferase inhibitor
Keywords: SYK, TRANSFERASE, KINASE, INHIBITOR COMPLEX, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2012-01-24, released 2012-04-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-04-25, with a file datestamp of 2012-04-20.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: 0.199
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase SYK
    Species: Homo sapiens [TaxId:9606]
    Gene: SYK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43405 (0-272)
      • expression tag (273)
    Domains in SCOPe 2.07: d4dfla1, d4dfla2
  • Heterogens: 0K0, EDO, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4dflA (A:)
    vyldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilkneandpalkdellaean
    vmqqldnpyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdkniielvhqvsmgm
    kyleesnfvhrdlaarnvllvtqhyakisdfglskalradenyykaqthgkwpvkwyape
    cinyykfssksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpagcpremy
    dlmnlcwtydvenrpgfaavelrlrnyyydvvne
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dflA (A:)
    vyldrklltledkelgsgtvkkgyyqmvvktvavkilpalkdellaeanvmqqldnpyiv
    rmigiceaeswmlvmemaelgplnkylqqnrhvkdkniielvhqvsmgmkyleesnfvhr
    dlaarnvllvtqhyakisdfglskalradenyykaqthgkwpvkwyapecinyykfssks
    dvwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpagcpremydlmnlcwtydv
    enrpgfaavelrlrnyyydvvne