PDB entry 4dfg

View 4dfg on RCSB PDB site
Description: Crystal Structure of Wild-type HIV-1 Protease with Cyclopentyltetrahydro- furanyl Urethanes as P2-ligand, GRL-0249A
Class: hydrolase/hydrolase inhibitor
Keywords: aspartic acid protease, HIV-1 protease inhibitor GRL-0249A, Cyclopentyltetrahydro- furanyl Urethanes P2-ligands, wild-type HIV-1 protease, hydrolase-hydrolase inhibitor complex
Deposited on 2012-01-23, released 2012-03-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-03-21, with a file datestamp of 2012-03-16.
Experiment type: XRAY
Resolution: 1.23 Å
R-factor: 0.146
AEROSPACI score: 0.82 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protease
    Species: Human immunodeficiency virus type 1 [TaxId:11686]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03367 (0-98)
      • engineered mutation (6)
      • engineered mutation (32)
      • engineered mutation (62)
      • engineered mutation (66)
      • engineered mutation (94)
    Domains in SCOPe 2.06: d4dfga_
  • Chain 'B':
    Compound: Protease
    Species: Human immunodeficiency virus type 1 [TaxId:11686]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03367 (0-98)
      • engineered mutation (6)
      • engineered mutation (32)
      • engineered mutation (62)
      • engineered mutation (66)
      • engineered mutation (94)
    Domains in SCOPe 2.06: d4dfgb_
  • Heterogens: NA, CL, 0JV, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4dfgA (A:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
    qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4dfgB (B:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
    qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf