PDB entry 4dem

View 4dem on RCSB PDB site
Description: Crystal structure of human FPPS in complex with YS_04_70
Class: transferase/transferase inhibitor
Keywords: MEVALONATE PATHWAY, ISOPRENE BIOSYNTHESIS, CHOLESTEROL BIOSYNTHESIS, BISPHOSPHONATE, TRANSFERASE, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2012-01-20, released 2012-03-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-04-25, with a file datestamp of 2012-04-20.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.175
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'F':
    Compound: farnesyl pyrophosphate synthase
    Species: Homo sapiens [TaxId:9606]
    Gene: FDPS, FPS, KIAA1293
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4demf_
  • Heterogens: YS4, MG, HOH

PDB Chain Sequences:

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4demF (F:)
    mgsshhhhhhssgrenlyfqghmngdqnsdvyaqekqdfvqhfsqivrvltedemghpei
    gdaiarlkevleynaiggkynrgltvvvafrelveprkqdadslqrawtvgwcvellqaf
    flvaddimdssltrrgqicwyqkpgvgldaindanlleaciyrllklycreqpyylnlie
    lflqssyqteigqtldlltapqgnvdlvrftekryksivkyktafysfylpiaaamymag
    idgekehanakkillemgeffqiqddyldlfgdpsvtgkigtdiqdnkcswlvvqclqra
    tpeqyqilkenygqkeaekvarvkalyeeldlpavflqyeedsyshimalieqyaaplpp
    avflglarkiykrrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4demF (F:)
    dvyaqekqdfvqhfsqivrvltedemghpeigdaiarlkevleynaiggkynrgltvvva
    frelveprkqdadslqrawtvgwcvellqafflvaddimdssltrrgqicwyqkpgvgld
    aindanlleaciyrllklycreqpyylnlielflqssyqteigqtldlltapqgnvdlvr
    ftekryksivkyktafysfylpiaaamymagidgekehanakkillemgeffqiqddyld
    lfgdpsvtgkigtdiqdnkcswlvvqclqratpeqyqilkenygqkeaekvarvkalyee
    ldlpavflqyeedsyshimalieqyaaplppavflglarkiykrrk