PDB entry 4deh

View 4deh on RCSB PDB site
Description: Crystal structure of c-Met in complex with triazolopyridinone inhibitor 3
Class: transferase/transferase inhibitor
Keywords: proto-oncogene, receptor tyrosine kinase, RTK, ATP-binding, hepatocyte growth factor/scatter factor, HGF/SF, phosphoprotein, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2012-01-20, released 2012-05-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-06-20, with a file datestamp of 2012-06-15.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.208
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hepatocyte growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: MET
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4deha_
  • Heterogens: 0JK, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4dehA (A:)
    qntvhidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkihc
    avkslnritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrn
    firnethnptvkdligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfglar
    dmydkeyysvhnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdv
    ntfditvyllqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfige
    hyvhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dehA (A:)
    idlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlkihcavkslnritdi
    gevsqfltegiimkdfshpnvlsllgiclrgsplvvlpymkhgdlrnfirnethnptvkd
    ligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfglardmydkeyysvhnk
    tgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvntfditvyllqgr
    rllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfig