PDB entry 4dea

View 4dea on RCSB PDB site
Description: Aurora A in complex with YL1-038-18
Class: transferase/transferase inhibitor
Keywords: PROTEIN KINASE, AURORA A, INHIBITOR, DFG-IN, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2012-01-20, released 2012-08-22
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-09-26, with a file datestamp of 2012-09-21.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.218
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aurora kinase A
    Species: Homo sapiens [TaxId:9606]
    Gene: AIK, AIRK1, ARK1, AURA, AURKA, AYK1, BTAK, IAK1, STK15, STK6
    Database cross-references and differences (RAF-indexed):
    • Uniprot O14965
      • engineered mutation (164)
    Domains in SCOPe 2.05: d4deaa_
  • Heterogens: EDO, NHI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4deaA (A:)
    skkrqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrrev
    eiqshlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelan
    alsychskrvihrdikpenlllgsagelkiadfgwsvhapssrrdtlcgtldylppemie
    grmhdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisr
    llkhnpsqrpmlrevlehpwitansskpsncqnkesask
    

    Sequence, based on observed residues (ATOM records): (download)
    >4deaA (A:)
    kkrqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreve
    iqshlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelana
    lsychskrvihrdikpenlllgsagelkiadfgwsvhapssrrdtlcgtldylppemieg
    rmhdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrl
    lkhnpsqrpmlrevlehpwitanssk