PDB entry 4dcn

View 4dcn on RCSB PDB site
Description: Crystal Structure Analysis of the Arfaptin2 BAR domain in Complex with ARL1
Class: protein binding/signaling protein
Keywords: Small GTPase Effector Complex, BAR domain, Membrane deformation, PROTEIN BINDING-SIGNALING PROTEIN complex
Deposited on 2012-01-18, released 2012-06-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-06-26, with a file datestamp of 2013-06-21.
Experiment type: XRAY
Resolution: 3.01 Å
R-factor: 0.264
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP-ribosylation factor-like protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ARL1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40616 (Start-165)
      • engineered mutation (57)
    Domains in SCOPe 2.06: d4dcna_
  • Chain 'B':
    Compound: ADP-ribosylation factor-like protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ARL1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40616 (Start-165)
      • engineered mutation (57)
    Domains in SCOPe 2.06: d4dcnb_
  • Chain 'C':
    Compound: Arfaptin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: ARFIP2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4dcnc_
  • Chain 'D':
    Compound: Arfaptin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: ARFIP2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4dcnd_
  • Heterogens: MG, GNP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4dcnA (A:)
    gtremrililgldgagkttilyrlqvgevvttiptigfnvetvtyknlkfqvwdlgglts
    irpywrcyysntdaviyvvdscdrdrigiskselvamleeeelrkailvvfankqdmeqa
    mtssemanslglpalkdrkwqifktsatkgtgldeamewlvetlks
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dcnA (A:)
    tremrililgldgagkttilyrlqvgevvttiptigfnvetvtyknlkfqvwdlggltsi
    rpywrcyysntdaviyvvdscdrdrigiskselvamleeeelrkailvvfankqdmeqam
    tssemanslglpalkdrkwqifktsatkgtgldeamewlvetlks
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4dcnB (B:)
    gtremrililgldgagkttilyrlqvgevvttiptigfnvetvtyknlkfqvwdlgglts
    irpywrcyysntdaviyvvdscdrdrigiskselvamleeeelrkailvvfankqdmeqa
    mtssemanslglpalkdrkwqifktsatkgtgldeamewlvetlks
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dcnB (B:)
    tremrililgldgagkttilyrlqvgevvttiptigfnvetvtyknlkfqvwdlggltsi
    rpywrcyysntdaviyvvdscdrdrigiskselvamleeeelrkailvvfankqdmeqam
    tssemanslglpalkdrkwqifktsatkgtgldeamewlvetlks
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4dcnC (C:)
    gsrtvdlelelqiellretkrkyesvlqlgraltahlysllqtqhalgdafadlsqkspe
    lqeefgynaetqkllckngetllgavnffvssintlvtktmedtlmtvkqyeaarleyda
    yrtdleelslgprdagtrgrlesaqatfqahrdkyeklrgdvaiklkfleenkikvmhkq
    lllfhnavsayfagnqkq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dcnC (C:)
    srtvdlelelqiellretkrkyesvlqlgraltahlysllqtqhalgdafadlsqkspel
    qeefgynaetqkllckngetllgavnffvssintlvtktmedtlmtvkqyeaarleyday
    rtdleelslgprdagtrgrlesaqatfqahrdkyeklrgdvaiklkfleenkikvmhkql
    llfhnavsayfag
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4dcnD (D:)
    gsrtvdlelelqiellretkrkyesvlqlgraltahlysllqtqhalgdafadlsqkspe
    lqeefgynaetqkllckngetllgavnffvssintlvtktmedtlmtvkqyeaarleyda
    yrtdleelslgprdagtrgrlesaqatfqahrdkyeklrgdvaiklkfleenkikvmhkq
    lllfhnavsayfagnqkq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dcnD (D:)
    rtvdlelelqiellretkrkyesvlqlgraltahlysllqtqhalgdafadlsqkspelq
    eefgynaetqkllckngetllgavnffvssintlvtktmedtlmtvkqyeaarleydayr
    tdleelslgprdagtrgrlesaqatfqahrdkyeklrgdvaiklkfleenkikvmhkqll
    lfhnavsayfagnqkq