PDB entry 4dc9

View 4dc9 on RCSB PDB site
Description: Hexameric ring of Methanococcus voltae RadA
Class: DNA binding protein
Keywords: Hexamer, RadA, Recombinase, Homologous Recombination, RecA, DNA BINDING PROTEIN
Deposited on 2012-01-17, released 2012-05-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-01-23, with a file datestamp of 2013-01-18.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.209
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA repair and recombination protein radA
    Species: Methanococcus voltae [TaxId:2188]
    Gene: RADA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O73948 (4-265)
      • expression tag (1-3)
    Domains in SCOPe 2.07: d4dc9a1, d4dc9a2
  • Chain 'B':
    Compound: DNA repair and recombination protein radA
    Species: Methanococcus voltae [TaxId:2188]
    Gene: RADA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O73948 (4-265)
      • expression tag (1-3)
    Domains in SCOPe 2.07: d4dc9b1, d4dc9b2
  • Chain 'C':
    Compound: DNA repair and recombination protein radA
    Species: Methanococcus voltae [TaxId:2188]
    Gene: RADA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O73948 (4-265)
      • expression tag (1-3)
    Domains in SCOPe 2.07: d4dc9c1, d4dc9c2
  • Chain 'D':
    Compound: DNA repair and recombination protein radA
    Species: Methanococcus voltae [TaxId:2188]
    Gene: RADA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O73948 (4-265)
      • expression tag (1-3)
    Domains in SCOPe 2.07: d4dc9d1, d4dc9d2
  • Chain 'E':
    Compound: DNA repair and recombination protein radA
    Species: Methanococcus voltae [TaxId:2188]
    Gene: RADA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O73948 (4-265)
      • expression tag (1-3)
    Domains in SCOPe 2.07: d4dc9e1, d4dc9e2
  • Chain 'F':
    Compound: DNA repair and recombination protein radA
    Species: Methanococcus voltae [TaxId:2188]
    Gene: RADA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O73948 (4-265)
      • expression tag (1-3)
    Domains in SCOPe 2.07: d4dc9f1, d4dc9f2
  • Heterogens: NO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4dc9A (A:)
    gshmdlgfksgidllkqrstvwklstssseldsvlggglesqsvtefagvfgsgktqimh
    qscvnlqnpeflfydeeavskgevaqpkavyidtegtfrperimqmaehagidgqtvldn
    tfvaraynsdmqmlfaekiedliqegnniklvvidsltstfrneytgrgklaerqqklgr
    hmatlnkladlfncvvlvtnqvsakpdaffgmaeqaigghivghaatfrffvrkgkgdkr
    vaklydsphlpdaeaifritekgiqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dc9A (A:)
    shmdlgfksgidllkqrstvwklstssseldsvlggglesqsvtefagvfgsgktqimhq
    scvnlqnpeflfydeeavskgevaqpkavyidtegtfrperimqmaehagidgqtvldnt
    fvaraynsdmqmlfaekiedliqegnniklvvidsltstfrneytgrgklaerqqklgrh
    matlnkladlfncvvlvtnqvsaaeqaigghivghaatfrffvrkgkgdkrvaklydsph
    lpdaeaifritekgiqd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4dc9B (B:)
    gshmdlgfksgidllkqrstvwklstssseldsvlggglesqsvtefagvfgsgktqimh
    qscvnlqnpeflfydeeavskgevaqpkavyidtegtfrperimqmaehagidgqtvldn
    tfvaraynsdmqmlfaekiedliqegnniklvvidsltstfrneytgrgklaerqqklgr
    hmatlnkladlfncvvlvtnqvsakpdaffgmaeqaigghivghaatfrffvrkgkgdkr
    vaklydsphlpdaeaifritekgiqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dc9B (B:)
    shmdlgfksgidllkqrstvwklstssseldsvlggglesqsvtefagvfgsgktqimhq
    scvnlqnpeflfydeeavskgevaqpkavyidtegtfrperimqmaehagidgqtvldnt
    fvaraynsdmqmlfaekiedliqegnniklvvidsltstfrneytgrgklaerqqklgrh
    matlnkladlfncvvlvtnqvsaaeqaigghivghaatfrffvrkgkgdkrvaklydsph
    lpdaeaifritekgiqd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4dc9C (C:)
    gshmdlgfksgidllkqrstvwklstssseldsvlggglesqsvtefagvfgsgktqimh
    qscvnlqnpeflfydeeavskgevaqpkavyidtegtfrperimqmaehagidgqtvldn
    tfvaraynsdmqmlfaekiedliqegnniklvvidsltstfrneytgrgklaerqqklgr
    hmatlnkladlfncvvlvtnqvsakpdaffgmaeqaigghivghaatfrffvrkgkgdkr
    vaklydsphlpdaeaifritekgiqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dc9C (C:)
    shmdlgfksgidllkqrstvwklstssseldsvlggglesqsvtefagvfgsgktqimhq
    scvnlqnpeflfydeeavskgevaqpkavyidtegtfrperimqmaehagidgqtvldnt
    fvaraynsdmqmlfaekiedliqegnniklvvidsltstfrneytgrgklaerqqklgrh
    matlnkladlfncvvlvtnqvsaaeqaigghivghaatfrffvrkgkgdkrvaklydsph
    lpdaeaifritekgiqd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4dc9D (D:)
    gshmdlgfksgidllkqrstvwklstssseldsvlggglesqsvtefagvfgsgktqimh
    qscvnlqnpeflfydeeavskgevaqpkavyidtegtfrperimqmaehagidgqtvldn
    tfvaraynsdmqmlfaekiedliqegnniklvvidsltstfrneytgrgklaerqqklgr
    hmatlnkladlfncvvlvtnqvsakpdaffgmaeqaigghivghaatfrffvrkgkgdkr
    vaklydsphlpdaeaifritekgiqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dc9D (D:)
    shmdlgfksgidllkqrstvwklstssseldsvlggglesqsvtefagvfgsgktqimhq
    scvnlqnpeflfydeeavskgevaqpkavyidtegtfrperimqmaehagidgqtvldnt
    fvaraynsdmqmlfaekiedliqegnniklvvidsltstfrneytgrgklaerqqklgrh
    matlnkladlfncvvlvtnqvsaaeqaigghivghaatfrffvrkgkgdkrvaklydsph
    lpdaeaifritekgiqd
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4dc9E (E:)
    gshmdlgfksgidllkqrstvwklstssseldsvlggglesqsvtefagvfgsgktqimh
    qscvnlqnpeflfydeeavskgevaqpkavyidtegtfrperimqmaehagidgqtvldn
    tfvaraynsdmqmlfaekiedliqegnniklvvidsltstfrneytgrgklaerqqklgr
    hmatlnkladlfncvvlvtnqvsakpdaffgmaeqaigghivghaatfrffvrkgkgdkr
    vaklydsphlpdaeaifritekgiqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dc9E (E:)
    shmdlgfksgidllkqrstvwklstssseldsvlggglesqsvtefagvfgsgktqimhq
    scvnlqnpeflfydeeavskgevaqpkavyidtegtfrperimqmaehagidgqtvldnt
    fvaraynsdmqmlfaekiedliqegnniklvvidsltstfrneytgrgklaerqqklgrh
    matlnkladlfncvvlvtnqvsaaeqaigghivghaatfrffvrkgkgdkrvaklydsph
    lpdaeaifritekgiqd
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4dc9F (F:)
    gshmdlgfksgidllkqrstvwklstssseldsvlggglesqsvtefagvfgsgktqimh
    qscvnlqnpeflfydeeavskgevaqpkavyidtegtfrperimqmaehagidgqtvldn
    tfvaraynsdmqmlfaekiedliqegnniklvvidsltstfrneytgrgklaerqqklgr
    hmatlnkladlfncvvlvtnqvsakpdaffgmaeqaigghivghaatfrffvrkgkgdkr
    vaklydsphlpdaeaifritekgiqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dc9F (F:)
    shmdlgfksgidllkqrstvwklstssseldsvlggglesqsvtefagvfgsgktqimhq
    scvnlqnpeflfydeeavskgevaqpkavyidtegtfrperimqmaehagidgqtvldnt
    fvaraynsdmqmlfaekiedliqegnniklvvidsltstfrneytgrgklaerqqklgrh
    matlnkladlfncvvlvtnqvsaaeqaigghivghaatfrffvrkgkgdkrvaklydsph
    lpdaeaifritekgiqd