PDB entry 4dc8

View 4dc8 on RCSB PDB site
Description: Crystal Structure of Myoglobin Unexposed to Excessive SONICC Imaging Laser Dose.
Class: oxygen storage
Keywords: sonicc, oxygen storage
Deposited on 2012-01-17, released 2013-01-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-05-15, with a file datestamp of 2013-05-10.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.183
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Equus caballus [TaxId:9796]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4dc8a_
  • Heterogens: HEM, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4dc8A (A:)
    glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
    lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
    gdfgadaqgamtkalelfrndiaakykelgfq