PDB entry 4dc1

View 4dc1 on RCSB PDB site
Description: Crystal Structure of Y202F Actinorhodin Polyketide Ketoreductase with NADPH
Class: oxidoreductase
Keywords: Rossmann fold, short-chain dehydrogenase/reductase, ketoreductase, OXIDOREDUCTASE
Deposited on 2012-01-16, released 2013-01-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-11-27, with a file datestamp of 2013-11-22.
Experiment type: XRAY
Resolution: 2.82 Å
R-factor: 0.19
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ketoacyl reductase
    Species: Streptomyces coelicolor [TaxId:1902]
    Gene: actIII, SCBAC28G1.12c, SCO5086
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16544 (Start-280)
      • engineered mutation (221)
    Domains in SCOPe 2.07: d4dc1a_
  • Chain 'B':
    Compound: ketoacyl reductase
    Species: Streptomyces coelicolor [TaxId:1902]
    Gene: actIII, SCBAC28G1.12c, SCO5086
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16544 (20-280)
      • engineered mutation (221)
    Domains in SCOPe 2.07: d4dc1b_
  • Heterogens: NDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4dc1A (A:)
    mgsshhhhhhssglvprgshmatqdsevalvtgatsgigleiarrlgkeglrvfvcarge
    eglrttlkelreagveadgrtcdvrsvpeiealvaavverygpvdvlvnnagrpgggata
    eladelwldvvetnltgvfrvtkqvlkaggmlergtgrivniastggkqgvvhaapysas
    khgvvgftkalglelartgitvnavcpgfvetpmaasvrehfsdiwevsteeafdritar
    vpigryvqpsevaemvayligpgaaavtaqalnvcgglgny
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dc1A (A:)
    qdsevalvtgatsgigleiarrlgkeglrvfvcargeeglrttlkelreagveadgrtcd
    vrsvpeiealvaavverygpvdvlvnnagrpgggataeladelwldvvetnltgvfrvtk
    qvlkaggmlergtgrivniastggkqgvvhaapysaskhgvvgftkalglelartgitvn
    avcpgfvetpmaasvrehfsdiwevsteeafdritarvpigryvqpsevaemvayligpg
    aaavtaqalnvcgglgny
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4dc1B (B:)
    mgsshhhhhhssglvprgshmatqdsevalvtgatsgigleiarrlgkeglrvfvcarge
    eglrttlkelreagveadgrtcdvrsvpeiealvaavverygpvdvlvnnagrpgggata
    eladelwldvvetnltgvfrvtkqvlkaggmlergtgrivniastggkqgvvhaapysas
    khgvvgftkalglelartgitvnavcpgfvetpmaasvrehfsdiwevsteeafdritar
    vpigryvqpsevaemvayligpgaaavtaqalnvcgglgny
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dc1B (B:)
    matqdsevalvtgatsgigleiarrlgkeglrvfvcargeeglrttlkelreagveadgr
    tcdvrsvpeiealvaavverygpvdvlvnnagrpgggataeladelwldvvetnltgvfr
    vtkqvlkaggmlergtgrivniastggkqgvvhaapysaskhgvvgftkalglelartgi
    tvnavcpgfvetpmaasvrehfsdiwevsteeafdritarvpigryvqpsevaemvayli
    gpgaaavtaqalnvcgglgny