PDB entry 4dbv

View 4dbv on RCSB PDB site
Description: glyceraldehyde-3-phosphate dehydrogenase mutant with leu 33 replaced by thr, thr 34 replaced by gly, asp 36 replaced by gly, leu 187 replaced by ala, and pro 188 replaced by ser complexed with nadp+
Class: oxidoreductase
Keywords: oxidoreductase, nad(p) selectivity
Deposited on 1997-01-06, released 1997-07-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.147
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'O':
    Compound: glyceraldehyde-3-phosphate dehydrogenase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: GAP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00362 (0-333)
      • engineered (33-35)
      • engineered (188-189)
    Domains in SCOPe 2.06: d4dbvo1, d4dbvo2
  • Chain 'P':
    Compound: glyceraldehyde-3-phosphate dehydrogenase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: GAP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00362 (0-333)
      • engineered (33-35)
      • engineered (188-189)
    Domains in SCOPe 2.06: d4dbvp1, d4dbvp2
  • Chain 'Q':
    Compound: glyceraldehyde-3-phosphate dehydrogenase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: GAP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00362 (0-333)
      • engineered (33-35)
      • engineered (188-189)
    Domains in SCOPe 2.06: d4dbvq1, d4dbvq2
  • Chain 'R':
    Compound: glyceraldehyde-3-phosphate dehydrogenase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: GAP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00362 (0-333)
      • engineered (33-35)
      • engineered (188-189)
    Domains in SCOPe 2.06: d4dbvr1, d4dbvr2
  • Heterogens: SO4, NDP, HOH

PDB Chain Sequences:

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4dbvO (O:)
    avkvgingfgrigrnvfraalknpdievvavndtggantlahllkydsvhgrldaevsvn
    gnnlvvngkeiivkaerdpenlawgeigvdivvestgrftkredaakhleagakkviisa
    pakneditivmgvnqdkydpkahhvisnascttnclapfakvlheqfgivrgmmttvhsy
    tndqrildashkdlrraraaaesiiptttgaakavalvlpelkgklngmamrvptpnvsv
    vdlvaelekevtveevnaalkaaaegelkgilayseeplvsrdyngstvsstidalstmv
    idgkmvkvvswydnetgyshrvvdlaayiaskgl
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4dbvP (P:)
    avkvgingfgrigrnvfraalknpdievvavndtggantlahllkydsvhgrldaevsvn
    gnnlvvngkeiivkaerdpenlawgeigvdivvestgrftkredaakhleagakkviisa
    pakneditivmgvnqdkydpkahhvisnascttnclapfakvlheqfgivrgmmttvhsy
    tndqrildashkdlrraraaaesiiptttgaakavalvlpelkgklngmamrvptpnvsv
    vdlvaelekevtveevnaalkaaaegelkgilayseeplvsrdyngstvsstidalstmv
    idgkmvkvvswydnetgyshrvvdlaayiaskgl
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4dbvQ (Q:)
    avkvgingfgrigrnvfraalknpdievvavndtggantlahllkydsvhgrldaevsvn
    gnnlvvngkeiivkaerdpenlawgeigvdivvestgrftkredaakhleagakkviisa
    pakneditivmgvnqdkydpkahhvisnascttnclapfakvlheqfgivrgmmttvhsy
    tndqrildashkdlrraraaaesiiptttgaakavalvlpelkgklngmamrvptpnvsv
    vdlvaelekevtveevnaalkaaaegelkgilayseeplvsrdyngstvsstidalstmv
    idgkmvkvvswydnetgyshrvvdlaayiaskgl
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4dbvR (R:)
    avkvgingfgrigrnvfraalknpdievvavndtggantlahllkydsvhgrldaevsvn
    gnnlvvngkeiivkaerdpenlawgeigvdivvestgrftkredaakhleagakkviisa
    pakneditivmgvnqdkydpkahhvisnascttnclapfakvlheqfgivrgmmttvhsy
    tndqrildashkdlrraraaaesiiptttgaakavalvlpelkgklngmamrvptpnvsv
    vdlvaelekevtveevnaalkaaaegelkgilayseeplvsrdyngstvsstidalstmv
    idgkmvkvvswydnetgyshrvvdlaayiaskgl