PDB entry 4dbn

View 4dbn on RCSB PDB site
Description: Crystal Structure of the Kinase domain of Human B-raf with a [1,3]thiazolo[5,4-b]pyridine derivative
Class: transferase/transferase inhibitor
Keywords: kinase drug complex, Ser/Thr Kinase, ATP Binding, Phosphorylation, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2012-01-16, released 2012-04-11
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-06-13, with a file datestamp of 2012-06-08.
Experiment type: XRAY
Resolution: 3.15 Å
R-factor: 0.198
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase B-raf
    Species: Homo sapiens [TaxId:9606]
    Gene: BRAF, BRAF1, P94, RAFB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4dbna_
  • Chain 'B':
    Compound: Serine/threonine-protein kinase B-raf
    Species: Homo sapiens [TaxId:9606]
    Gene: BRAF, BRAF1, P94, RAFB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4dbnb_
  • Heterogens: 0JA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4dbnA (A:)
    gsdssddweipdgqitvgqrigsgsfgtvykgkwhgdvavkmlnvtaptpqqlqafknev
    gvlrktrhvnillfmgystkpqlaivtqwcegsslyhhlhiietkfemiklidiarqtaq
    gmdylhaksiihrdlksnniflhedltvkigdfglatvksrwsgshqfeqlsgsilwmap
    evirmqdknpysfqsdvyafgivlyelmtgqlpysninnrdqiifmvgrgylspdlskvr
    sncpkamkrlmaeclkkkrderplfpqilasiellarslpkihr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dbnA (A:)
    ddweipdgqitvgqrigsgsfgtvykgkwhgdvavkmlnvtaptpqqlqafknevgvlrk
    trhvnillfmgystkpqlaivtqwcegsslyhhlhiietkfemiklidiarqtaqgmdyl
    haksiihrdlksnniflhedltvkigdfglgsilwmapevirmqdknpysfqsdvyafgi
    vlyelmtgqlpysninnrdqiifmvgrgylspdlskvrsncpkamkrlmaeclkkkrder
    plfpqilasiellarsl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4dbnB (B:)
    gsdssddweipdgqitvgqrigsgsfgtvykgkwhgdvavkmlnvtaptpqqlqafknev
    gvlrktrhvnillfmgystkpqlaivtqwcegsslyhhlhiietkfemiklidiarqtaq
    gmdylhaksiihrdlksnniflhedltvkigdfglatvksrwsgshqfeqlsgsilwmap
    evirmqdknpysfqsdvyafgivlyelmtgqlpysninnrdqiifmvgrgylspdlskvr
    sncpkamkrlmaeclkkkrderplfpqilasiellarslpkihr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dbnB (B:)
    ddweipdgqitvgqrigsgsfgtvykgkwhgdvavkmlnvtaptpqqlqafknevgvlrk
    trhvnillfmgystkpqlaivtqwcegsslyhhlhiietkfemiklidiarqtaqgmdyl
    haksiihrdlksnniflhedltvkigdfglatvksrwgsilwmapevirmqdknpysfqs
    dvyafgivlyelmtgqlpysninnrdqiifmvgrgylspdlskvrsncpkamkrlmaecl
    kkkrderplfpqilasiellars