PDB entry 4dbk

View 4dbk on RCSB PDB site
Description: Crystal structure of porcine pancreatic phospholipase A2 complexed with berberine
Class: hydrolase/hydrolase inhibitor
Keywords: Monomeric protein, berberine, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2012-01-16, released 2012-01-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-01-25, with a file datestamp of 2012-01-20.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.188
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: phospholipase a2, major isoenzyme
  Species: Sus scrofa [TaxId:9823]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00592 (0-123)
  Domains in SCOPe 2.08: d4dbka_
• Heterogens: CA, BER, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4dbkA (A:)
  alwqfrsmikcaipgshplmdfnnygcycglggsgtpvdeldrccethdncyrdaknlds
  ckflvdnpytesysyscsnteitcnsknnaceaficncdrnaaicfskapynkehknldt
  kkyc