PDB entry 4dbb

View 4dbb on RCSB PDB site
Description: The PTB domain of Mint1 is autoinhibited by a helix in the C-terminal linker region
Class: protein transport
Keywords: x11s/mints, ptb domain, chimera protein, protein transport
Deposited on 2012-01-13, released 2012-03-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Amyloid beta A4 precursor protein-binding family A member 1
    Species: Rattus norvegicus [TaxId:10116]
    Gene: APBA1, MINT1, X11
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4dbba_
  • Heterogens: CL, ACY, IPA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4dbbA (A:)
dpedlidgiifaanylgstqllsdktpsknvrmmqaqeavsrikpegesqpmtevdlfis
tqrikvlnadtqepmmdhplrtisyiadignivvlmarrrmprsqykmichvfesedaql
iaqsigqafsvayqeflranginpedlsqkeysdllntqdmy

    Sequence, based on observed residues (ATOM records): (download) 
    >4dbbA (A:)
edlidgiifaanylgstqllsdktpsknvrmmqaqeavsrikqpmtevdlfistqrikvl
nadtqepmmdhplrtisyiadignivvlmarrrmprsqykmichvfesedaqliaqsigq
afsvayqeflrainpedlsqkeysdllntq