PDB entry 4db7

View 4db7 on RCSB PDB site
Description: Crystal structure of B. anthracis DHPS with compound 25
Class: transferase/transferase inhibitor
Keywords: TIM Barrel, Transferase, pABA, DHPP, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2012-01-13, released 2012-03-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-05-09, with a file datestamp of 2012-05-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.233
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydropteroate synthase
    Species: Bacillus anthracis [TaxId:191218]
    Gene: FolP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4db7a_
  • Chain 'B':
    Compound: dihydropteroate synthase
    Species: Bacillus anthracis [TaxId:191218]
    Gene: FolP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4db7b_
  • Heterogens: Z25, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4db7A (A:)
    mgsshhhhhhssglvprgshmkwdydlrcgeytlnlnektlimgilnvtpdsfsdggsyn
    evdaavrhakemrdegahiidiggestrpgfakvsveeeikrvvpmiqavskevklpisi
    dtykaevakqaieagahiindiwgakaepkiaevaahydvpiilmhnrdnmnyrnlmadm
    iadlydsikiakdagvrdeniildpgigfaktpeqnleamrnleqlnvlgypvllgtsrk
    sfighvldlpveerlegtgatvclgiekgcefvrvhdvkemsrmakmmdamigkgvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4db7A (A:)
    kwdydlrcgeytlnlnektlimgilndsfsdggsynevdaavrhakemrdegahiidigs
    veeeikrvvpmiqavskevklpisidtykaevakqaieagahiindiwgakaepkiaeva
    ahydvpiilmhnrdnmnyrnlmadmiadlydsikiakdagvrdeniildpgigfaktpeq
    nleamrnleqlnvlgypvllgtsrksfighvldlpveerlegtgatvclgiekgcefvrv
    hdvkemsrmakmmdamigk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4db7B (B:)
    mgsshhhhhhssglvprgshmkwdydlrcgeytlnlnektlimgilnvtpdsfsdggsyn
    evdaavrhakemrdegahiidiggestrpgfakvsveeeikrvvpmiqavskevklpisi
    dtykaevakqaieagahiindiwgakaepkiaevaahydvpiilmhnrdnmnyrnlmadm
    iadlydsikiakdagvrdeniildpgigfaktpeqnleamrnleqlnvlgypvllgtsrk
    sfighvldlpveerlegtgatvclgiekgcefvrvhdvkemsrmakmmdamigkgvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4db7B (B:)
    kwdydlrcgeytlnlnektlimgilndggsynevdaavrhakemrdegahiidigsveee
    ikrvvpmiqavskevklpisidtykaevakqaieagahiindiwgakaepkiaevaahyd
    vpiilmhnrdnmnyrnlmadmiadlydsikiakdagvrdeniildpgigfaktpeqnlea
    mrnleqlnvlgypvllgtsrksfighvldlpveerlegtgatvclgiekgcefvrvhdvk
    emsrmakmmdamigk