PDB entry 4db5

View 4db5 on RCSB PDB site
Description: Crystal structure of Rabbit GITRL
Class: immune system
Keywords: GITRL, GLUCOCORTICOID-INDUCED TNF RECEPTOR LIGAND, IMMUNE SYSTEM, TNFRSF18, Structural genomics
Deposited on 2012-01-13, released 2012-03-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-06-06, with a file datestamp of 2012-06-01.
Experiment type: XRAY
Resolution: 1.52 Å
R-factor: 0.161
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tumor necrosis factor ligand superfamily member 18
    Species: Oryctolagus cuniculus [TaxId:9986]
    Gene: GITRL, TNFSF18
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4db5a_
  • Heterogens: B3P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4db5A (A:)
    takeacvakfgplpskwqmeppkpscvnkisdwklkilqnglyiiygqvapdptykgfap
    fevqlcknkeaiqtltnnskiqnlggiyefdagdiielrfnsddqvlknntywgivllvt
    pqfss
    

    Sequence, based on observed residues (ATOM records): (download)
    >4db5A (A:)
    acvakfgplpskwqmeppkpscvnkisdwklkilqnglyiiygqvapdptykgfapfevq
    lcknkeaiqtltnnskiqnlggiyefdagdiielrfnsddqvlknntywgivllvtpqfs
    s