SCOPe 2.06: Structural Classification of Proteins

PDB entry 4dam

View 4dam on RCSB PDB site
Description: Crystal structure of small single-stranded DNA-binding protein from Streptomyces coelicolor
Class: DNA binding protein
Keywords: OB-fold, DNA-binding, single-stranded DNA, DNA BINDING PROTEIN
Deposited on 2012-01-13, released 2013-01-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-04-10, with a file datestamp of 2013-04-05.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.155
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Single-stranded DNA-binding protein 1
Species: Streptomyces coelicolor [TaxId:1902]
Gene: SCC61A.04c, SCO2683, ssb1
Database cross-references and differences (RAF-indexed):
- Uniprot Q9KYI9 (12-End)
  - expression tag (11)
  - engineered mutation (15)
Domains in SCOPe 2.06: d4dama1, d4dama2
Chain 'B':
Compound: Single-stranded DNA-binding protein 1
Species: Streptomyces coelicolor [TaxId:1902]
Gene: SCC61A.04c, SCO2683, ssb1
Database cross-references and differences (RAF-indexed):
- Uniprot Q9KYI9 (12-End)
  - engineered mutation (15)
Domains in SCOPe 2.06: d4damb_
Chain 'C':
Compound: Single-stranded DNA-binding protein 1
Species: Streptomyces coelicolor [TaxId:1902]
Gene: SCC61A.04c, SCO2683, ssb1
Database cross-references and differences (RAF-indexed):
- Uniprot Q9KYI9 (12-End)
  - expression tag (11)
  - engineered mutation (15)
Domains in SCOPe 2.06: d4damc1, d4damc2
Chain 'D':
Compound: Single-stranded DNA-binding protein 1
Species: Streptomyces coelicolor [TaxId:1902]
Gene: SCC61A.04c, SCO2683, ssb1
Database cross-references and differences (RAF-indexed):
- Uniprot Q9KYI9 (12-End)
  - engineered mutation (15)
Domains in SCOPe 2.06: d4damd_
Chain 'E':
Compound: Single-stranded DNA-binding protein 1
Species: Streptomyces coelicolor [TaxId:1902]
Gene: SCC61A.04c, SCO2683, ssb1
Database cross-references and differences (RAF-indexed):
- Uniprot Q9KYI9 (12-End)
  - expression tag (11)
  - engineered mutation (15)
Domains in SCOPe 2.06: d4dame1, d4dame2
Chain 'F':
Compound: Single-stranded DNA-binding protein 1
Species: Streptomyces coelicolor [TaxId:1902]
Gene: SCC61A.04c, SCO2683, ssb1
Database cross-references and differences (RAF-indexed):
- Uniprot Q9KYI9 (12-End)
  - engineered mutation (15)
Domains in SCOPe 2.06: d4damf_
Chain 'G':
Compound: Single-stranded DNA-binding protein 1
Species: Streptomyces coelicolor [TaxId:1902]
Gene: SCC61A.04c, SCO2683, ssb1
Database cross-references and differences (RAF-indexed):
- Uniprot Q9KYI9 (12-End)
  - expression tag (11)
  - engineered mutation (15)
Domains in SCOPe 2.06: d4damg1, d4damg2
Chain 'H':
Compound: Single-stranded DNA-binding protein 1
Species: Streptomyces coelicolor [TaxId:1902]
Gene: SCC61A.04c, SCO2683, ssb1
Database cross-references and differences (RAF-indexed):
- Uniprot Q9KYI9 (12-End)
  - engineered mutation (15)
Domains in SCOPe 2.06: d4damh_
Chain 'I':
Compound: Single-stranded DNA-binding protein 1
Species: Streptomyces coelicolor [TaxId:1902]
Gene: SCC61A.04c, SCO2683, ssb1
Database cross-references and differences (RAF-indexed):
- Uniprot Q9KYI9 (12-End)
  - engineered mutation (15)
Domains in SCOPe 2.06: d4dami_
Chain 'J':
Compound: Single-stranded DNA-binding protein 1
Species: Streptomyces coelicolor [TaxId:1902]
Gene: SCC61A.04c, SCO2683, ssb1
Database cross-references and differences (RAF-indexed):
- Uniprot Q9KYI9 (12-End)
  - engineered mutation (15)
Domains in SCOPe 2.06: d4damj_
Chain 'K':
Compound: Single-stranded DNA-binding protein 1
Species: Streptomyces coelicolor [TaxId:1902]
Gene: SCC61A.04c, SCO2683, ssb1
Database cross-references and differences (RAF-indexed):
- Uniprot Q9KYI9 (12-End)
  - expression tag (11)
  - engineered mutation (15)
Domains in SCOPe 2.06: d4damk1, d4damk2
Chain 'L':
Compound: Single-stranded DNA-binding protein 1
Species: Streptomyces coelicolor [TaxId:1902]
Gene: SCC61A.04c, SCO2683, ssb1
Database cross-references and differences (RAF-indexed):
- Uniprot Q9KYI9 (12-End)
  - engineered mutation (15)
Domains in SCOPe 2.06: d4daml_
Heterogens: HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>4damA (A:)
mrgshhhhhhgsmneimicavgnvattpvfrdlangpsvrfrlavtarywdreknawtdg
htnfftvwanrqlatnasgslavgdpvvvqgrlkvrtdvregqsrtsadidavaighdla
rgtaafrr