PDB entry 4dam

View 4dam on RCSB PDB site
Description: Crystal structure of small single-stranded DNA-binding protein from Streptomyces coelicolor
Class: DNA binding protein
Keywords: OB-fold, DNA-binding, single-stranded DNA, DNA BINDING PROTEIN
Deposited on 2012-01-13, released 2013-01-16
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-04-10, with a file datestamp of 2013-04-05.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.155
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Single-stranded DNA-binding protein 1
    Species: Streptomyces coelicolor [TaxId:1902]
    Gene: SCC61A.04c, SCO2683, ssb1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KYI9 (12-End)
      • expression tag (11)
      • engineered mutation (15)
    Domains in SCOPe 2.04: d4dama_
  • Chain 'B':
    Compound: Single-stranded DNA-binding protein 1
    Species: Streptomyces coelicolor [TaxId:1902]
    Gene: SCC61A.04c, SCO2683, ssb1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KYI9 (12-End)
      • engineered mutation (15)
    Domains in SCOPe 2.04: d4damb_
  • Chain 'C':
    Compound: Single-stranded DNA-binding protein 1
    Species: Streptomyces coelicolor [TaxId:1902]
    Gene: SCC61A.04c, SCO2683, ssb1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KYI9 (12-End)
      • expression tag (11)
      • engineered mutation (15)
    Domains in SCOPe 2.04: d4damc_
  • Chain 'D':
    Compound: Single-stranded DNA-binding protein 1
    Species: Streptomyces coelicolor [TaxId:1902]
    Gene: SCC61A.04c, SCO2683, ssb1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KYI9 (12-End)
      • engineered mutation (15)
    Domains in SCOPe 2.04: d4damd_
  • Chain 'E':
    Compound: Single-stranded DNA-binding protein 1
    Species: Streptomyces coelicolor [TaxId:1902]
    Gene: SCC61A.04c, SCO2683, ssb1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KYI9 (12-End)
      • expression tag (11)
      • engineered mutation (15)
    Domains in SCOPe 2.04: d4dame_
  • Chain 'F':
    Compound: Single-stranded DNA-binding protein 1
    Species: Streptomyces coelicolor [TaxId:1902]
    Gene: SCC61A.04c, SCO2683, ssb1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KYI9 (12-End)
      • engineered mutation (15)
    Domains in SCOPe 2.04: d4damf_
  • Chain 'G':
    Compound: Single-stranded DNA-binding protein 1
    Species: Streptomyces coelicolor [TaxId:1902]
    Gene: SCC61A.04c, SCO2683, ssb1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KYI9 (12-End)
      • expression tag (11)
      • engineered mutation (15)
    Domains in SCOPe 2.04: d4damg_
  • Chain 'H':
    Compound: Single-stranded DNA-binding protein 1
    Species: Streptomyces coelicolor [TaxId:1902]
    Gene: SCC61A.04c, SCO2683, ssb1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KYI9 (12-End)
      • engineered mutation (15)
    Domains in SCOPe 2.04: d4damh_
  • Chain 'I':
    Compound: Single-stranded DNA-binding protein 1
    Species: Streptomyces coelicolor [TaxId:1902]
    Gene: SCC61A.04c, SCO2683, ssb1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KYI9 (12-End)
      • engineered mutation (15)
    Domains in SCOPe 2.04: d4dami_
  • Chain 'J':
    Compound: Single-stranded DNA-binding protein 1
    Species: Streptomyces coelicolor [TaxId:1902]
    Gene: SCC61A.04c, SCO2683, ssb1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KYI9 (12-End)
      • engineered mutation (15)
    Domains in SCOPe 2.04: d4damj_
  • Chain 'K':
    Compound: Single-stranded DNA-binding protein 1
    Species: Streptomyces coelicolor [TaxId:1902]
    Gene: SCC61A.04c, SCO2683, ssb1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KYI9 (12-End)
      • expression tag (11)
      • engineered mutation (15)
    Domains in SCOPe 2.04: d4damk_
  • Chain 'L':
    Compound: Single-stranded DNA-binding protein 1
    Species: Streptomyces coelicolor [TaxId:1902]
    Gene: SCC61A.04c, SCO2683, ssb1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KYI9 (12-End)
      • engineered mutation (15)
    Domains in SCOPe 2.04: d4daml_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4damA (A:)
    mrgshhhhhhgsmneimicavgnvattpvfrdlangpsvrfrlavtarywdreknawtdg
    htnfftvwanrqlatnasgslavgdpvvvqgrlkvrtdvregqsrtsadidavaighdla
    rgtaafrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4damA (A:)
    smneimicavgnvattpvfrdlangpsvrfrlavtarywdreknawtdghtnfftvwanr
    qlatnasgslavgdpvvvqgrlkvrtdvregqsrtsadidavaighdlargta
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4damB (B:)
    mrgshhhhhhgsmneimicavgnvattpvfrdlangpsvrfrlavtarywdreknawtdg
    htnfftvwanrqlatnasgslavgdpvvvqgrlkvrtdvregqsrtsadidavaighdla
    rgtaafrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4damB (B:)
    mneimicavgnvattpvfrdlangpsvrfrlavtarywdknawtdghtnfftvwanrqla
    tnasgslavgdpvvvqgrlkvrtdvregqsrtsadidavaighdlarg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4damC (C:)
    mrgshhhhhhgsmneimicavgnvattpvfrdlangpsvrfrlavtarywdreknawtdg
    htnfftvwanrqlatnasgslavgdpvvvqgrlkvrtdvregqsrtsadidavaighdla
    rgtaafrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4damC (C:)
    smneimicavgnvattpvfrdlangpsvrfrlavtarywdawtdghtnfftvwanrqlat
    nasgslavgdpvvvqgrlkvrrtsadidavaighdlargt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4damD (D:)
    mrgshhhhhhgsmneimicavgnvattpvfrdlangpsvrfrlavtarywdreknawtdg
    htnfftvwanrqlatnasgslavgdpvvvqgrlkvrtdvregqsrtsadidavaighdla
    rgtaafrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4damD (D:)
    mneimicavgnvattpvfrdlangpsvrfrlavtarywdreknawtdghtnfftvwanrq
    latnasgslavgdpvvvqgrlkvrtdvregqsrtsadidavaighdlar
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4damE (E:)
    mrgshhhhhhgsmneimicavgnvattpvfrdlangpsvrfrlavtarywdreknawtdg
    htnfftvwanrqlatnasgslavgdpvvvqgrlkvrtdvregqsrtsadidavaighdla
    rgtaafrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4damE (E:)
    smneimicavgnvattpvfrdlangpsvrfrlavtarywdreknawtdghtnfftvwanr
    qlatnasgslavgdpvvvqgrlkvrtdvregqsrtsadidavaighdlargt
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4damF (F:)
    mrgshhhhhhgsmneimicavgnvattpvfrdlangpsvrfrlavtarywdreknawtdg
    htnfftvwanrqlatnasgslavgdpvvvqgrlkvrtdvregqsrtsadidavaighdla
    rgtaafrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4damF (F:)
    mneimicavgnvattpvfrdlangpsvrfrlavtarywdreknawtdghtnfftvwanrq
    latnasgslavgdpvvvqgrlkvrtdvregqsrtsadidavaighdlarg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4damG (G:)
    mrgshhhhhhgsmneimicavgnvattpvfrdlangpsvrfrlavtarywdreknawtdg
    htnfftvwanrqlatnasgslavgdpvvvqgrlkvrtdvregqsrtsadidavaighdla
    rgtaafrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4damG (G:)
    smneimicavgnvattpvfrdlangpsvrfrlavtarywwtdghtnfftvwanrqlatna
    sgslavgdpvvvqgrlkvrtrtsadidavaighdlarg
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4damH (H:)
    mrgshhhhhhgsmneimicavgnvattpvfrdlangpsvrfrlavtarywdreknawtdg
    htnfftvwanrqlatnasgslavgdpvvvqgrlkvrtdvregqsrtsadidavaighdla
    rgtaafrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4damH (H:)
    mneimicavgnvattpvfrdlangpsvrfrlavtarywdreawtdghtnfftvwanrqla
    tnasgslavgdpvvvqgrlkvrtdvregqsrtsadidavaighdlarg
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4damI (I:)
    mrgshhhhhhgsmneimicavgnvattpvfrdlangpsvrfrlavtarywdreknawtdg
    htnfftvwanrqlatnasgslavgdpvvvqgrlkvrtdvregqsrtsadidavaighdla
    rgtaafrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4damI (I:)
    mneimicavgnvattpvfrdlangpsvrfrlavtarywdreknawtdghtnfftvwanrq
    latnasgslavgdpvvvqgrlkvrtdvregqsrtsadidavaighdlarg
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4damJ (J:)
    mrgshhhhhhgsmneimicavgnvattpvfrdlangpsvrfrlavtarywdreknawtdg
    htnfftvwanrqlatnasgslavgdpvvvqgrlkvrtdvregqsrtsadidavaighdla
    rgtaafrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4damJ (J:)
    mneimicavgnvattpvfrdlangpsvrfrlavtarywnawtdghtnfftvwanrqlatn
    asgslavgdpvvvqgrlkvrtdvregqsrtsadidavaighdlargta
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >4damK (K:)
    mrgshhhhhhgsmneimicavgnvattpvfrdlangpsvrfrlavtarywdreknawtdg
    htnfftvwanrqlatnasgslavgdpvvvqgrlkvrtdvregqsrtsadidavaighdla
    rgtaafrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4damK (K:)
    smneimicavgnvattpvfrdlangpsvrfrlavtarywdreknawtdghtnfftvwanr
    qlatnasgslavgdpvvvqgrlkvrtdvregqsrtsadidavaighdlarg
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4damL (L:)
    mrgshhhhhhgsmneimicavgnvattpvfrdlangpsvrfrlavtarywdreknawtdg
    htnfftvwanrqlatnasgslavgdpvvvqgrlkvrtdvregqsrtsadidavaighdla
    rgtaafrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4damL (L:)
    mneimicavgnvattpvfrdlangpsvrfrlavtarywdnawtdghtnfftvwanrqlat
    nasgslavgdpvvvqgrlkvrtrtsadidavaighdlarg