PDB entry 4daf

View 4daf on RCSB PDB site
Description: Crystal structure of B. anthracis DHPS with compound 19
Class: transferase/transferase inhibitor
Keywords: TIM Barrel, DHPS inhibitor, Transferase, pABA, DHPP, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2012-01-12, released 2012-04-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-05-09, with a file datestamp of 2012-05-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.237
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydropteroate synthase
    Species: Bacillus anthracis [TaxId:191218]
    Gene: FolP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4dafa_
  • Chain 'B':
    Compound: dihydropteroate synthase
    Species: Bacillus anthracis [TaxId:191218]
    Gene: FolP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4dafb_
  • Heterogens: 0J4, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4dafA (A:)
    mgsshhhhhhssglvprgshmkwdydlrcgeytlnlnektlimgilnvtpdsfsdggsyn
    evdaavrhakemrdegahiidiggestrpgfakvsveeeikrvvpmiqavskevklpisi
    dtykaevakqaieagahiindiwgakaepkiaevaahydvpiilmhnrdnmnyrnlmadm
    iadlydsikiakdagvrdeniildpgigfaktpeqnleamrnleqlnvlgypvllgtsrk
    sfighvldlpveerlegtgatvclgiekgcefvrvhdvkemsrmakmmdamigkgvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dafA (A:)
    kwdydlrcgeytlnlnektlimgilnsynevdaavrhakemrdegahiidigsveeeikr
    vvpmiqavskevklpisidtykaevakqaieagahiindiwgakaepkiaevaahydvpi
    ilmhnrdnmnyrnlmadmiadlydsikiakdagvrdeniildpgigfaktpeqnleamrn
    leqlnvlgypvllgtsrksfighvldlpveerlegtgatvclgiekgcefvrvhdvkems
    rmakmmdamigk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4dafB (B:)
    mgsshhhhhhssglvprgshmkwdydlrcgeytlnlnektlimgilnvtpdsfsdggsyn
    evdaavrhakemrdegahiidiggestrpgfakvsveeeikrvvpmiqavskevklpisi
    dtykaevakqaieagahiindiwgakaepkiaevaahydvpiilmhnrdnmnyrnlmadm
    iadlydsikiakdagvrdeniildpgigfaktpeqnleamrnleqlnvlgypvllgtsrk
    sfighvldlpveerlegtgatvclgiekgcefvrvhdvkemsrmakmmdamigkgvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4dafB (B:)
    kwdydlrcgeytlnlnektlimgilnsynevdaavrhakemrdegahiidigsveeeikr
    vvpmiqavskevklpisidtykaevakqaieagahiindiwgakaepkiaevaahydvpi
    ilmhnrdnmnyrnlmadmiadlydsikiakdagvrdeniildpgigfaktpeqnleamrn
    leqlnvlgypvllgtsrksfighvldlpveerlegtgatvclgiekgcefvrvhdvkems
    rmakmmdamigk