PDB entry 4da9

View 4da9 on RCSB PDB site
Description: Crystal structure of putative Short-chain dehydrogenase/reductase from Sinorhizobium meliloti 1021
Class: oxidoreductase
Keywords: STRUCTURAL GENOMICS, PROTEIN STRUCTURE INITIATIVE, dehydrogenase/reductase, PSI-Biology, New York Structural Genomics Research Consortium, NYSGRC, OXIDOREDUCTASE
Deposited on 2012-01-12, released 2012-01-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-04-02, with a file datestamp of 2014-03-28.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.18
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: short-chain dehydrogenase/reductase
    Species: Sinorhizobium meliloti [TaxId:266834]
    Gene: R03296, SMc04391
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92L02 (23-End)
      • expression tag (22)
    Domains in SCOPe 2.07: d4da9a1, d4da9a2
  • Chain 'B':
    Compound: short-chain dehydrogenase/reductase
    Species: Sinorhizobium meliloti [TaxId:266834]
    Gene: R03296, SMc04391
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4da9b_
  • Chain 'C':
    Compound: short-chain dehydrogenase/reductase
    Species: Sinorhizobium meliloti [TaxId:266834]
    Gene: R03296, SMc04391
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92L02 (23-End)
      • expression tag (22)
    Domains in SCOPe 2.07: d4da9c1, d4da9c2
  • Chain 'D':
    Compound: short-chain dehydrogenase/reductase
    Species: Sinorhizobium meliloti [TaxId:266834]
    Gene: R03296, SMc04391
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4da9d_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4da9A (A:)
    mhhhhhhssgvdlgtenlyfqsmmtqkarpvaivtggrrgiglgiaralaasgfdiaitg
    igdaegvapviaelsglgarviflradladlsshqatvdavvaefgridclvnnagiasi
    vrddfldlkpenfdtivgvnlrgtvfftqavlkamlasdarasrsiinitsvsavmtspe
    rldycmskaglaafsqglalrlaetgiavfevrpgiirsdmtaavsgkydgliesglvpm
    rrwgepedignivaglaggqfgfatgsviqadgglsigrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4da9A (A:)
    mmtqkarpvaivtggrrgiglgiaralaasgfdiaitgigdaegvapviaelsglgarvi
    flradladlsshqatvdavvaefgridclvnnagddfldlkpenfdtivgvnlrgtvfft
    qavlkamlasdarasrsiinitsverldycmskaglaafsqglalrlaetgiavfevrpg
    iirsrwgepedignivaglaggqfgfatgsviqadggls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4da9B (B:)
    mhhhhhhssgvdlgtenlyfqsmmtqkarpvaivtggrrgiglgiaralaasgfdiaitg
    igdaegvapviaelsglgarviflradladlsshqatvdavvaefgridclvnnagiasi
    vrddfldlkpenfdtivgvnlrgtvfftqavlkamlasdarasrsiinitsvsavmtspe
    rldycmskaglaafsqglalrlaetgiavfevrpgiirsdmtaavsgkydgliesglvpm
    rrwgepedignivaglaggqfgfatgsviqadgglsigrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4da9B (B:)
    qkarpvaivtggrrgiglgiaralaasgfdiaitgigdaegvapviaelsglgarviflr
    adladlsshqatvdavvaefgridclvnnagiddfldlkpenfdtivgvnlrgtvfftqa
    vlkamlasdarasrsiinitsverldycmskaglaafsqglalrlaetgiavfevrpgiw
    gepedignivaglaggqfgfatgsviqadgglsigr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4da9C (C:)
    mhhhhhhssgvdlgtenlyfqsmmtqkarpvaivtggrrgiglgiaralaasgfdiaitg
    igdaegvapviaelsglgarviflradladlsshqatvdavvaefgridclvnnagiasi
    vrddfldlkpenfdtivgvnlrgtvfftqavlkamlasdarasrsiinitsvsavmtspe
    rldycmskaglaafsqglalrlaetgiavfevrpgiirsdmtaavsgkydgliesglvpm
    rrwgepedignivaglaggqfgfatgsviqadgglsigrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4da9C (C:)
    mmtqkarpvaivtggrrgiglgiaralaasgfdiaitgigdaegvapviaelsglgarvi
    flradladlsshqatvdavvaefgridclvnnagrddfldlkpenfdtivgvnlrgtvff
    tqavlkamlasdarasrsiinitsverldycmskaglaafsqglalrlaetgiavfevrp
    giirsrwgepedignivaglaggqfgfatgsviqadggls
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4da9D (D:)
    mhhhhhhssgvdlgtenlyfqsmmtqkarpvaivtggrrgiglgiaralaasgfdiaitg
    igdaegvapviaelsglgarviflradladlsshqatvdavvaefgridclvnnagiasi
    vrddfldlkpenfdtivgvnlrgtvfftqavlkamlasdarasrsiinitsvsavmtspe
    rldycmskaglaafsqglalrlaetgiavfevrpgiirsdmtaavsgkydgliesglvpm
    rrwgepedignivaglaggqfgfatgsviqadgglsigrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4da9D (D:)
    mtqkarpvaivtggrrgiglgiaralaasgfdiaitgigdaegvapviaelsglgarvif
    lradladlsshqatvdavvaefgridclvnnaddfldlkpenfdtivgvnlrgtvfftqa
    vlkamlasdarasrsiinitsvperldycmskaglaafsqglalrlaetgiavfevrpgi
    irsrwgepedignivaglaggqfgfatgsviqadgglsi