PDB entry 4d7t

View 4d7t on RCSB PDB site
Description: Structure of the SthK Carboxy-Terminal Region in complex with cAMP
Class: transport protein
Keywords: transport protein
Deposited on 2014-11-27, released 2015-02-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-23, with a file datestamp of 2017-08-18.
Experiment type: XRAY
Resolution: 2.58 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sthk_cnbd_camp
    Species: SPIROCHAETA THERMOPHILA DSM 6192 [TaxId:665571]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4d7ta_
  • Chain 'B':
    Compound: sthk_cnbd_camp
    Species: SPIROCHAETA THERMOPHILA DSM 6192 [TaxId:665571]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4d7tb_
  • Heterogens: CMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4d7tA (A:)
    daakllhrermervtaflsykkispelqrrileyfdylwetrrgyeerevlkelphplrl
    avameihgdviekvplfkgagedfirdiilhlepviygpgeyiiragelgsdvyfinrgs
    vevlsadektryailsegqffgemalilraprtatvrartfcdlyrldketfdrilsryp
    eiaaqiqelavrrkeele
    

    Sequence, based on observed residues (ATOM records): (download)
    >4d7tA (A:)
    daakllhrermervtaflsykkispelqrrileyfdylwetrrgyeerevlkelphplrl
    avameihgdviekvplfkgagedfirdiilhlepviygpgeyiiragelgsdvyfinrgs
    vevlsadektryailsegqffgemalilraprtatvrartfcdlyrldketfdrilsryp
    eaaqiqelavrrkeele
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4d7tB (B:)
    daakllhrermervtaflsykkispelqrrileyfdylwetrrgyeerevlkelphplrl
    avameihgdviekvplfkgagedfirdiilhlepviygpgeyiiragelgsdvyfinrgs
    vevlsadektryailsegqffgemalilraprtatvrartfcdlyrldketfdrilsryp
    eiaaqiqelavrrkeele
    

    Sequence, based on observed residues (ATOM records): (download)
    >4d7tB (B:)
    aakllhrermervtaflsykkispelqrrileyfdylwetryrevlpplrlavamedvie
    klffidiilhlepviygpgeyiiragelgsdvyfinrgsvevlsadektryailsegqff
    gemalilraprtatvrartfcdlyrlketfdrlsyeiaaqiqelavrrkeele