PDB entry 4d7n

View 4d7n on RCSB PDB site
Description: TetR(D) in complex with anhydrotetracycline and potassium
Class: transcription
Keywords: transcription, repressor, antibiotic resistance, tetr
Deposited on 2014-11-25, released 2014-12-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-04-22, with a file datestamp of 2015-04-17.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tetracycline repressor, class d
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4d7na1, d4d7na2, d4d7na3
  • Heterogens: TDC, K, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4d7nA (A:)
    srlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveila
    rhhdyslpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmt
    engfslrdglyaisavshftlgavleqqehtaaltdrpaapdenlppllrealqimdsdd
    geqaflhgleslirgfevqltallqivggdkliipfc
    

    Sequence, based on observed residues (ATOM records): (download)
    >4d7nA (A:)
    srlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveila
    rhhdyslpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmt
    engfslrdglyaisavshftlgavleqqehtanlppllrealqimdsddgeqaflhgles
    lirgfevqltallqivg