PDB entry 4d7b

View 4d7b on RCSB PDB site
Description: Structure of human transthyretin in complex with Tolcapone
Class: transport protein
Keywords: transport protein, amyloidogenesis
Deposited on 2014-11-21, released 2016-01-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-03-02, with a file datestamp of 2016-02-26.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: N/A
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4d7ba_
  • Chain 'B':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4d7bb_
  • Heterogens: TCW, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4d7bA (A:)
    mgptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhglt
    teeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystt
    avvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >4d7bA (A:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4d7bB (B:)
    mgptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhglt
    teeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystt
    avvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >4d7bB (B:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp