PDB entry 4d71

View 4d71 on RCSB PDB site
Description: Crystal structure of a family 98 glycoside hydrolase catalytic module (Sp3GH98) in complex with the type 2 blood group A-tetrasaccharide (E558A X02 mutant)
Class: hydrolase
Keywords: hydrolase, blood group antigen
Deposited on 2014-11-19, released 2015-01-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-05, with a file datestamp of 2017-06-30.
Experiment type: XRAY
Resolution: 1.77 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycoside hydrolase
    Species: STREPTOCOCCUS PNEUMONIAE [TaxId:406556]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5LBQ0 (0-582)
      • expression tag (583-585)
      • engineered mutation (137-138)
      • engineered mutation (171)
    Domains in SCOPe 2.07: d4d71a1, d4d71a2, d4d71a3
  • Heterogens: FUC, GAL, NAG, A2G, EDO, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4d71A (A:)
    evdkrreinnehpllmmplyangeefnqgkytfwggdtltgkwenipddlkpytviqlhp
    ddlpkrdgaardfyehmleeaakyvnpktgknepipviltvytagnmpyytsahwlstsw
    idkmyqkypnlhgifstasywiwandienkaadylkvsaknggyfiwaeqnsgsaiekaf
    gkngkiafqksvdkywknlifmfkntpaaegndsttesymkglwlsnhtyqwgglmdtwk
    wyetgkwklfasgnigksqgdrqwltepesmlgeealgvylnggvvynfehpaytygvnn
    kesllfsevikeffryviahpapskekvledtkvfihgdysnkgngkffvnvntdreqtp
    lymtgrynvipaipgvlktdklkesvsssriqikeitspefsstqarkeylnklypmnye
    gdifaqkldnrwfvynykvnenvkqtgklkfnslemnvefephtygiferisnglkvnln
    nfrtnkdslwsnaqdanqakklpqltkkgaikwieehyikdtqfgekrvtkivlrgidkl
    ptihslsgtnnsydqpslnfdqknhmvtitinsngnlefelhflehppppplrsgc
    

    Sequence, based on observed residues (ATOM records): (download)
    >4d71A (A:)
    evdkrreinnehpllmmplyangeefnqgkytfwggdtltgkwenipddlkpytviqlhp
    ddlpkrdgaardfyehmleeaakyvnpktgknepipviltvytagnmpyytsahwlstsw
    idkmyqkypnlhgifstasywiwandienkaadylkvsaknggyfiwaeqnsgsaiekaf
    gkngkiafqksvdkywknlifmfkntpaaegndsttesymkglwlsnhtyqwgglmdtwk
    wyetgkwklfasgnigksqgdrqwltepesmlgeealgvylnggvvynfehpaytygvnn
    kesllfsevikeffryviahpapskekvledtkvfihgdysnkgngkffvnvntdreqtp
    lymtgrynvipaipgvlktdklkesvsssriqikeitspefsstqarkeylnklypmnye
    gdifaqkldnrwfvynykvnenvkqtgklkfnslemnvefephtygiferisnglkvnln
    nfrtnkdslwsnaqdanqakklpqltkkgaikwieehyikdtqfgekrvtkivlrgidkl
    ptihslsgtnnsydqpslnfdqknhmvtitinsngnlefelhfleh