PDB entry 4d6q

View 4d6q on RCSB PDB site
Description: crystal structure of human JMJD2D in complex with 2,4-PDCA
Class: transcription
Keywords: transcription, kdm4d, flj10251, mgc141909, demethylase/2og, jumonji domain containing 2d
Deposited on 2014-11-14, released 2014-12-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-12-24, with a file datestamp of 2014-12-19.
Experiment type: XRAY
Resolution: 1.29 Å
R-factor: 0.1361
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lysine-specific demethylase 4D
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4d6qa_
  • Heterogens: ZN, NI, PD2, EDO, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4d6qA (A:)
    smetmkskancaqnpncnimifhptkeefndfdkyiaymesqgahraglakiippkewka
    retydniseiliatplqqvasgragvftqyhkkkkamtvgeyrhlanskkyqtpphqnfe
    dlerkywknriynspiygadisgslfdentkqwnlghlgtiqdllekecgvviegvntpy
    lyfgmwkttfawhtedmdlysinylhlgepktwyvvppehgqrlerlarelfpgssrgcg
    aflrhkvalisptvlkengipfnritqeagefmvtfpygyhagfnhgfncaeainfatpr
    widygkmasqcscgearvtfsmdafvrilqperydlwkrgqdr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4d6qA (A:)
    aqnpncnimifhptkeefndfdkyiaymesqgahraglakiippkewkaretydniseil
    iatplqqvasgragvftqyhkkkkamtvgeyrhlanskkyqtpphqnfedlerkywknri
    ynspiygadisgslfdentkqwnlghlgtiqdllekecgvviegvntpylyfgmwkttfa
    whtedmdlysinylhlgepktwyvvppehgqrlerlarelfpgssrgcgaflrhkvalis
    ptvlkengipfnritqeagefmvtfpygyhagfnhgfncaeainfatprwidygkmasqc
    scgearvtfsmdafvrilqperydlwkrgq