PDB entry 4d6e

View 4d6e on RCSB PDB site
Description: Crystal structure of a family 98 glycoside hydrolase catalytic module (Sp3GH98) in complex with the blood group A-trisaccharide (X01 mutant)
Class: hydrolase
Keywords: hydrolase, glycoside hydrolase, blood group antigen
Deposited on 2014-11-11, released 2014-11-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-05-20, with a file datestamp of 2015-05-15.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: N/A
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycoside hydrolase
    Species: STREPTOCOCCUS PNEUMONIAE [TaxId:406556]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5LBQ0 (0-582)
      • expression tag (583-585)
      • engineered mutation (138)
      • engineered mutation (171)
    Domains in SCOPe 2.06: d4d6ea1, d4d6ea2, d4d6ea3
  • Heterogens: SO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4d6eA (A:)
    evdkrreinnehpllmmplyangeefnqgkytfwggdtltgkwenipddlkpytviqlhp
    ddlpkrdgaardfyehmleeaakyvnpktgknepipviltvytagnmpyytsahwlstsw
    idkmyqkypnlhgifstesywiwandienkaadylkvsaknggyfiwaeqnvgsaiekaf
    gkngkiafqksvdkywknlifmfkntpaaegndsttesymkglwlsnhtyqwgglmdtwk
    wyetgkwklfasgnigksqgdrqwltepesmlgeealgvylnggvvynfehpaytygvnn
    kesllfsevikeffryviahpapskekvledtkvfihgdysnkgngkffvnvntdreqtp
    lymtgrynvipaipgvlktdklkesvsssriqikeitspefsstqarkeylnklypmnye
    gdifaqkldnrwfvynykvnenvkqtgklkfnslemnvefephtygiferisnglkvnln
    nfrtnkdslwsnaqdanqakklpqltkkgaikwieehyikdtqfgekrvtkivlrgidkl
    ptihslsgtnnsydqpslnfdqknhmvtitinsngnlefelhflehtrappppplrsgc
    

    Sequence, based on observed residues (ATOM records): (download)
    >4d6eA (A:)
    evdkrreinnehpllmmplyangeefnqgkytfwggdtltgkwenipddlkpytviqlhp
    ddlpkrdgaardfyehmleeaakyvnpktgknepipviltvytagnmpyytsahwlstsw
    idkmyqkypnlhgifstesywiwandienkaadylkvsaknggyfiwaeqnvgsaiekaf
    gkngkiafqksvdkywknlifmfkntpaaegndsttesymkglwlsnhtyqwgglmdtwk
    wyetgkwklfasgnigksqgdrqwltepesmlgeealgvylnggvvynfehpaytygvnn
    kesllfsevikeffryviahpapskekvledtkvfihgdysnkgngkffvnvntdreqtp
    lymtgrynvipaipgvlktdkliqikeitspefsstqarkeylnklypmnyegdifaqkl
    dnrwfvynykvnenvkqtgklkfnslemnvefephtygiferisnglkvnlnnfrtnkds
    lwsnaqdanqakklpqltkkgaikwieehyikdtqfgekrvtkivlrgidklptihslsg
    tnnsydqpslnfdqknhmvtitinsngnlefelhfleh