PDB entry 4d5v

View 4d5v on RCSB PDB site
Description: Hypocrea jecorina cellobiohydrolase Cel7A E217Q soaked with xylotetraose.
Class: hydrolase
Keywords: hydrolase, glycoside hydrolase, cellobiohydrolase, cellulase. inhibition, xylooligosaccharides
Deposited on 2014-11-07, released 2015-03-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.62 Å
R-factor: N/A
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cellulose 1,4-beta-cellobiosidase
    Species: HYPOCREA JECORINA [TaxId:51453]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62694 (0-433)
      • cloning artifact (93)
      • engineered mutation (216)
    Domains in SCOPe 2.08: d4d5va_
  • Heterogens: CO, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4d5vA (A:)
    esactlqsethppltwqkcssggtctqqtgsvvidanwrwthatnsstncydgntwsstl
    cpdnetcaknccldgaayastygvttsgnslsidfvtqsaqknvgarlylmasdttyqef
    tllgnefsfdvdvsqlpcglngalyfvsmdadggvskyptntagakygtgycdsqcprdl
    kfingqanvegwepssnnantgigghgsccsemdiwqansisealtphpcttvgqeiceg
    dgcggtysdnryggtcdpdgcdwnpyrlgntsfygpgssftldttkkltvvtqfetsgai
    nryyvqngvtfqqpnaelgsysgnelnddyctaeeaefggssfsdkggltqfkkatsggm
    vlvmslwddyyanmlwldstyptnetsstpgavrgscstssgvpaqvesqspnakvtfsn
    ikfgpigstgnpsg