PDB entry 4d3p

View 4d3p on RCSB PDB site
Description: crystal structure of point mutated DUSP19 (C150A)
Class: hydrolase
Keywords: hydrolase, dusp19, point mutation
Deposited on 2014-10-23, released 2015-11-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-11-04, with a file datestamp of 2015-10-30.
Experiment type: XRAY
Resolution: 1.27 Å
R-factor: N/A
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Dual specificity protein phosphatase 19
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8WTR2 (6-146)
    • expression tag (0-5)
    • engineered mutation (91)
  Domains in SCOPe 2.08: d4d3pa1, d4d3pa2
• Heterogens: SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4d3pA (A:)
  gshmasqvgvikpwlllgsqdaahdldtlkknkvthilnvaygvenaflsdftyksisil
  dlpetnilsyfpecfefieeakrkdgvvlvhanagvsraaaivigflmnseqtsftsafs
  lvknarpsicpnsgfmeqlrtyqegke