PDB entry 4d3e

View 4d3e on RCSB PDB site
Description: Tetramer of IpaD, modified from 2J0O, fitted into negative stain electron microscopy reconstruction of the wild type tip complex from the type III secretion system of Shigella flexneri
Class: cell invasion
Keywords: cell invasion, tip complex, type III secretion system, shigella flexneri, wild type, ipad
Deposited on 2014-10-21, released 2014-12-10
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-12-10, with a file datestamp of 2014-12-05.
Experiment type: EM
Resolution: 2.12 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'D':
    Compound: invasin ipad
    Species: SHIGELLA FLEXNERI 5A STR. M90T [TaxId:1086030]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4d3ed_

PDB Chain Sequences:

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4d3eD (D:)
    gdqmishrelwakiansindineqylkvyehavssytqmyqdfsavlsslagwispggnd
    gnsvklqvnslkkaleelkekykdkplypanntvsqeqankwltelggtigkvsqknggy
    vvsinmtpidnmlksldnlggngevvldnakyqawnagfsaedetmknnlqtlvqkysna
    nsifdnlvkvlsstissctdtdklflhf