PDB entry 4d1p

View 4d1p on RCSB PDB site
Description: Structure of human endothelial nitric oxide synthase heme domain IN COMPLEX WITH 6-((((3S, 5R)-5-(((6-AMINO-4-METHYLPYRIDIN-2-YL)METHOXY) METHYL)PYRROLIDIN-3-YL)OXY) METHYL)-4-METHYLPYRIDIN-2-AMINE
Class: oxidoreductase
Keywords: oxidoreductase, nitric oxide synthase,
Deposited on 2014-05-02, released 2014-10-15
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-10-15, with a file datestamp of 2014-10-10.
Experiment type: XRAY
Resolution: 1.73 Å
R-factor: 0.158
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nitric oxide synthase, endothelial
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4d1pa_
  • Chain 'B':
    Compound: Nitric oxide synthase, endothelial
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ACT, HEM, H4B, Q16, BTB, GOL, ZN, GD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4d1pA (A:)
    apasllppapehsppsspltqppegpkfprvknwevgsitydtlsaqaqqdgpctprrcl
    gslvfprklqgrpspgppapeqllsqardfinqyyssikrsgsqaheqrlqeveaevaat
    gtyqlreselvfgakqawrnaprcvgriqwgklqvfdardcrsaqemftyicnhikyatn
    rgnlrsaitvfpqrcpgrgdfriwnsqlvryagyrqqdgsvrgdpanveitelciqhgwt
    pgngrfdvlplllqapdeppelfllppelvlevplehptlewfaalglrwyalpavsnml
    leigglefpaapfsgwymsteigtrnlcdphryniledvavcmdldtrttsslwkdkaav
    einvavlhsyqlakvtivdhhaatasfmkhleneqkarggcpadwawivppisgsltpvf
    hqemvnyflspafryqpdpw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4d1pA (A:)
    fprvknwevgsitydtlsaqaqqdgpctprrclgslvfpapeqllsqardfinqyyssik
    rsgsqaheqrlqeveaevaatgtyqlreselvfgakqawrnaprcvgriqwgklqvfdar
    dcrsaqemftyicnhikyatnrgnlrsaitvfpqrcpgrgdfriwnsqlvryagyrqqdg
    svrgdpanveitelciqhgwtpgngrfdvlplllqapdeppelfllppelvlevplehpt
    lewfaalglrwyalpavsnmlleigglefpaapfsgwymsteigtrnlcdphryniledv
    avcmdldtrttsslwkdkaaveinvavlhsyqlakvtivdhhaatasfmkhleneqkarg
    gcpadwawivppisgsltpvfhqemvnyflspafryqpdpw
    

  • Chain 'B':
    No sequence available.