PDB entry 4d1o

View 4d1o on RCSB PDB site
Description: Structure of human endothelial nitric oxide synthase heme domain with L-Arg bound
Class: oxidoreductase
Keywords: oxidoreductase, nitric oxide synthase,
Deposited on 2014-05-02, released 2014-10-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-10-22, with a file datestamp of 2014-10-17.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: 0.1566
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nitric oxide synthase, endothelial
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4d1oa_
  • Chain 'B':
    Compound: Nitric oxide synthase, endothelial
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4d1ob_
  • Heterogens: ARG, HEM, ACT, BTB, GOL, ZN, H4B, GD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4d1oA (A:)
    apasllppapehsppsspltqppegpkfprvknwevgsitydtlsaqaqqdgpctprrcl
    gslvfprklqgrpspgppapeqllsqardfinqyyssikrsgsqaheqrlqeveaevaat
    gtyqlreselvfgakqawrnaprcvgriqwgklqvfdardcrsaqemftyicnhikyatn
    rgnlrsaitvfpqrcpgrgdfriwnsqlvryagyrqqdgsvrgdpanveitelciqhgwt
    pgngrfdvlplllqapdeppelfllppelvlevplehptlewfaalglrwyalpavsnml
    leigglefpaapfsgwymsteigtrnlcdphryniledvavcmdldtrttsslwkdkaav
    einvavlhsyqlakvtivdhhaatasfmkhleneqkarggcpadwawivppisgsltpvf
    hqemvnyflspafryqpdpw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4d1oA (A:)
    fprvknwevgsitydtlsaqaqqdgpctprrclgslvfpapeqllsqardfinqyyssik
    rsgsqaheqrlqeveaevaatgtyqlreselvfgakqawrnaprcvgriqwgklqvfdar
    dcrsaqemftyicnhikyatnrgnlrsaitvfpqrcpgrgdfriwnsqlvryagyrqqdg
    svrgdpanveitelciqhgwtpgngrfdvlplllqapdeppelfllppelvlevplehpt
    lewfaalglrwyalpavsnmlleigglefpaapfsgwymsteigtrnlcdphryniledv
    avcmdldtrttsslwkdkaaveinvavlhsyqlakvtivdhhaatasfmkhleneqkarg
    gcpadwawivppisgsltpvfhqemvnyflspafryqpdpw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4d1oB (B:)
    apasllppapehsppsspltqppegpkfprvknwevgsitydtlsaqaqqdgpctprrcl
    gslvfprklqgrpspgppapeqllsqardfinqyyssikrsgsqaheqrlqeveaevaat
    gtyqlreselvfgakqawrnaprcvgriqwgklqvfdardcrsaqemftyicnhikyatn
    rgnlrsaitvfpqrcpgrgdfriwnsqlvryagyrqqdgsvrgdpanveitelciqhgwt
    pgngrfdvlplllqapdeppelfllppelvlevplehptlewfaalglrwyalpavsnml
    leigglefpaapfsgwymsteigtrnlcdphryniledvavcmdldtrttsslwkdkaav
    einvavlhsyqlakvtivdhhaatasfmkhleneqkarggcpadwawivppisgsltpvf
    hqemvnyflspafryqpdpw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4d1oB (B:)
    kfprvknwevgsitydtlsaqaqqdgpctprrclgslvfpapeqllsqardfinqyyssi
    krsgsqaheqrlqeveaevaatgtyqlreselvfgakqawrnaprcvgriqwgklqvfda
    rdcrsaqemftyicnhikyatnrgnlrsaitvfpqrcpgrgdfriwnsqlvryagyrqqd
    gsvrgdpanveitelciqhgwtpgngrfdvlplllqapdeppelfllppelvlevplehp
    tlewfaalglrwyalpavsnmlleigglefpaapfsgwymsteigtrnlcdphryniled
    vavcmdldtrttsslwkdkaaveinvavlhsyqlakvtivdhhaatasfmkhleneqkar
    ggcpadwawivppisgsltpvfhqemvnyflspafryqpdpw