PDB entry 4d1n

View 4d1n on RCSB PDB site
Description: Structure of human nNOS heme domain with L-Arg bound
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2014-05-02, released 2014-10-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-10-22, with a file datestamp of 2014-10-17.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: 0.17855
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nitric oxide synthase, brain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29475 (0-419)
      • engineered mutation (52)
      • engineered mutation (55)
    Domains in SCOPe 2.05: d4d1na_
  • Chain 'B':
    Compound: Nitric oxide synthase, brain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29475 (0-419)
      • engineered mutation (52)
      • engineered mutation (55)
    Domains in SCOPe 2.05: d4d1nb_
  • Chain 'C':
    Compound: Nitric oxide synthase, brain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29475 (0-419)
      • engineered mutation (52)
      • engineered mutation (55)
    Domains in SCOPe 2.05: d4d1nc_
  • Chain 'D':
    Compound: Nitric oxide synthase, brain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29475 (0-419)
      • engineered mutation (52)
      • engineered mutation (55)
    Domains in SCOPe 2.05: d4d1nd_
  • Heterogens: ARG, HEM, H4B, GOL, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4d1nA (A:)
    cprflkvknwetevvltdtlhlkstletgcteyicmgsimhpsqharrpedvatkdqlfp
    lakefidqyyssikrfgskahmerleevnkeidttstyqlkdteliygakhawrnasrcv
    griqwsklqvfdardcttahgmfnyicnhvkyatnkgnlrsaitifpqrtdgkhdfrvwn
    sqliryagykqpdgstlgdpanvqfteiciqqgwkpprgrfdvlplllqangndpelfqi
    ppelvlevpirhpkfewfkdlglkwyglpavsnmlleigglefsacpfsgwymgteigvr
    dycdnsrynileevakkmnldmrktsslwkdqalveiniavlysfqsdkvtivdhhsate
    sfikhmeneyrcrggcpadwvwivppmsgsitpvfhqemlnyrltpsfeyqpdpwnthvw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4d1nB (B:)
    cprflkvknwetevvltdtlhlkstletgcteyicmgsimhpsqharrpedvatkdqlfp
    lakefidqyyssikrfgskahmerleevnkeidttstyqlkdteliygakhawrnasrcv
    griqwsklqvfdardcttahgmfnyicnhvkyatnkgnlrsaitifpqrtdgkhdfrvwn
    sqliryagykqpdgstlgdpanvqfteiciqqgwkpprgrfdvlplllqangndpelfqi
    ppelvlevpirhpkfewfkdlglkwyglpavsnmlleigglefsacpfsgwymgteigvr
    dycdnsrynileevakkmnldmrktsslwkdqalveiniavlysfqsdkvtivdhhsate
    sfikhmeneyrcrggcpadwvwivppmsgsitpvfhqemlnyrltpsfeyqpdpwnthvw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4d1nB (B:)
    cprflkvknwetevvltdtlhlkstletgcteyicmgsimhpvatkdqlfplakefidqy
    yssikrfgskahmerleevnkeidttstyqlkdteliygakhawrnasrcvgriqwsklq
    vfdardcttahgmfnyicnhvkyatnkgnlrsaitifpqrtdgkhdfrvwnsqliryagy
    kqpdgstlgdpanvqfteiciqqgwkpprgrfdvlplllqangndpelfqippelvlevp
    irhpkfewfkdlglkwyglpavsnmlleigglefsacpfsgwymgteigvrdycdnsryn
    ileevakkmnldmrktsslwkdqalveiniavlysfqsdkvtivdhhsatesfikhmene
    yrcrggcpadwvwivppmsgsitpvfhqemlnyrltpsfeyqpdpwnthvw
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4d1nC (C:)
    cprflkvknwetevvltdtlhlkstletgcteyicmgsimhpsqharrpedvatkdqlfp
    lakefidqyyssikrfgskahmerleevnkeidttstyqlkdteliygakhawrnasrcv
    griqwsklqvfdardcttahgmfnyicnhvkyatnkgnlrsaitifpqrtdgkhdfrvwn
    sqliryagykqpdgstlgdpanvqfteiciqqgwkpprgrfdvlplllqangndpelfqi
    ppelvlevpirhpkfewfkdlglkwyglpavsnmlleigglefsacpfsgwymgteigvr
    dycdnsrynileevakkmnldmrktsslwkdqalveiniavlysfqsdkvtivdhhsate
    sfikhmeneyrcrggcpadwvwivppmsgsitpvfhqemlnyrltpsfeyqpdpwnthvw
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4d1nD (D:)
    cprflkvknwetevvltdtlhlkstletgcteyicmgsimhpsqharrpedvatkdqlfp
    lakefidqyyssikrfgskahmerleevnkeidttstyqlkdteliygakhawrnasrcv
    griqwsklqvfdardcttahgmfnyicnhvkyatnkgnlrsaitifpqrtdgkhdfrvwn
    sqliryagykqpdgstlgdpanvqfteiciqqgwkpprgrfdvlplllqangndpelfqi
    ppelvlevpirhpkfewfkdlglkwyglpavsnmlleigglefsacpfsgwymgteigvr
    dycdnsrynileevakkmnldmrktsslwkdqalveiniavlysfqsdkvtivdhhsate
    sfikhmeneyrcrggcpadwvwivppmsgsitpvfhqemlnyrltpsfeyqpdpwnthvw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4d1nD (D:)
    cprflkvknwetevvltdtlhlkstletgcteyicmgsimhpvatkdqlfplakefidqy
    yssikrfgskahmerleevnkeidttstyqlkdteliygakhawrnasrcvgriqwsklq
    vfdardcttahgmfnyicnhvkyatnkgnlrsaitifpqrtdgkhdfrvwnsqliryagy
    kqpdgstlgdpanvqfteiciqqgwkpprgrfdvlplllqangndpelfqippelvlevp
    irhpkfewfkdlglkwyglpavsnmlleigglefsacpfsgwymgteigvrdycdnsryn
    ileevakkmnldmrktsslwkdqalveiniavlysfqsdkvtivdhhsatesfikhmene
    yrcrggcpadwvwivppmsgsitpvfhqemlnyrltpsfeyqpdpwnthvw