PDB entry 4d1m

View 4d1m on RCSB PDB site
Description: Tetramerization domain of zebrafish p53 (crystal form II)
Class: transcription
Keywords: transcription, p53 family, tumor suppressor, transcription factor, tetramer, protein evolution
Deposited on 2014-05-02, released 2014-08-27
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-09-17, with a file datestamp of 2014-09-12.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.22845
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cellular tumor antigen p53
    Species: Danio rerio [TaxId:7955]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4d1ma_
  • Chain 'B':
    Compound: Cellular tumor antigen p53
    Species: Danio rerio [TaxId:7955]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4d1mb_
  • Chain 'C':
    Compound: Cellular tumor antigen p53
    Species: Danio rerio [TaxId:7955]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4d1mc_
  • Chain 'D':
    Compound: Cellular tumor antigen p53
    Species: Danio rerio [TaxId:7955]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4d1md_
  • Chain 'E':
    Compound: Cellular tumor antigen p53
    Species: Danio rerio [TaxId:7955]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4d1me_
  • Chain 'F':
    Compound: Cellular tumor antigen p53
    Species: Danio rerio [TaxId:7955]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4d1mf_
  • Chain 'G':
    Compound: Cellular tumor antigen p53
    Species: Danio rerio [TaxId:7955]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4d1mg_
  • Chain 'H':
    Compound: Cellular tumor antigen p53
    Species: Danio rerio [TaxId:7955]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4d1mh_
  • Chain 'I':
    Compound: Cellular tumor antigen p53
    Species: Danio rerio [TaxId:7955]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4d1mi_
  • Chain 'J':
    Compound: Cellular tumor antigen p53
    Species: Danio rerio [TaxId:7955]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4d1mj_
  • Chain 'K':
    Compound: Cellular tumor antigen p53
    Species: Danio rerio [TaxId:7955]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4d1mk_
  • Chain 'L':
    Compound: Cellular tumor antigen p53
    Species: Danio rerio [TaxId:7955]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4d1ml_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4d1mA (A:)
    ggseeiftlqvrgreryeilkklndslelsdvvpasdaekyrqkfmtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4d1mA (A:)
    eiftlqvrgreryeilkklndslelsdvvpasdaekyr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4d1mB (B:)
    ggseeiftlqvrgreryeilkklndslelsdvvpasdaekyrqkfmtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4d1mB (B:)
    eiftlqvrgreryeilkklndslelsdvvpasdaekyrqk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4d1mC (C:)
    ggseeiftlqvrgreryeilkklndslelsdvvpasdaekyrqkfmtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4d1mC (C:)
    eeiftlqvrgreryeilkklndslelsdvvpasdaekyrq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4d1mD (D:)
    ggseeiftlqvrgreryeilkklndslelsdvvpasdaekyrqkfmtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4d1mD (D:)
    eiftlqvrgreryeilkklndslelsdvvpasdaekyrq
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4d1mE (E:)
    ggseeiftlqvrgreryeilkklndslelsdvvpasdaekyrqkfmtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4d1mE (E:)
    eiftlqvrgreryeilkklndslelsdvvpasdaekyrqkfm
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4d1mF (F:)
    ggseeiftlqvrgreryeilkklndslelsdvvpasdaekyrqkfmtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4d1mF (F:)
    eiftlqvrgreryeilkklndslelsdvvpasdaekyrqkf
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4d1mG (G:)
    ggseeiftlqvrgreryeilkklndslelsdvvpasdaekyrqkfmtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4d1mG (G:)
    eeiftlqvrgreryeilkklndslelsdvvpasdaekyrq
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4d1mH (H:)
    ggseeiftlqvrgreryeilkklndslelsdvvpasdaekyrqkfmtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4d1mH (H:)
    eiftlqvrgreryeilkklndslelsdvvpasdaekyrqk
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4d1mI (I:)
    ggseeiftlqvrgreryeilkklndslelsdvvpasdaekyrqkfmtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4d1mI (I:)
    eiftlqvrgreryeilkklndslelsdvvpasdaekyrq
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4d1mJ (J:)
    ggseeiftlqvrgreryeilkklndslelsdvvpasdaekyrqkfmtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4d1mJ (J:)
    eiftlqvrgreryeilkklndslelsdvvpasdaekyrq
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >4d1mK (K:)
    ggseeiftlqvrgreryeilkklndslelsdvvpasdaekyrqkfmtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4d1mK (K:)
    eeiftlqvrgreryeilkklndslelsdvvpasdaekyrq
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4d1mL (L:)
    ggseeiftlqvrgreryeilkklndslelsdvvpasdaekyrqkfmtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4d1mL (L:)
    eiftlqvrgreryeilkklndslelsdvvpasdaekyrq