PDB entry 4d1l

View 4d1l on RCSB PDB site
Description: Tetramerization domain of zebrafish p53 (crystal form I)
Class: transcription
Keywords: transcription, p53 family, tumor suppressor, transcription factor, tetramer, protein evolution
Deposited on 2014-05-02, released 2014-08-27
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-09-17, with a file datestamp of 2014-09-12.
Experiment type: XRAY
Resolution: 1.97 Å
R-factor: 0.21876
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cellular tumor antigen p53
    Species: Danio rerio [TaxId:7955]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4d1la_
  • Chain 'B':
    Compound: Cellular tumor antigen p53
    Species: Danio rerio [TaxId:7955]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4d1lb_
  • Chain 'C':
    Compound: Cellular tumor antigen p53
    Species: Danio rerio [TaxId:7955]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4d1lc_
  • Chain 'D':
    Compound: Cellular tumor antigen p53
    Species: Danio rerio [TaxId:7955]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4d1ld_
  • Chain 'E':
    Compound: Cellular tumor antigen p53
    Species: Danio rerio [TaxId:7955]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4d1le_
  • Chain 'F':
    Compound: Cellular tumor antigen p53
    Species: Danio rerio [TaxId:7955]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4d1lf_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4d1lA (A:)
ggseeiftlqvrgreryeilkklndslelsdvvpasdaekyrqkfmtk

    Sequence, based on observed residues (ATOM records): (download) 
    >4d1lA (A:)
eiftlqvrgreryeilkklndslelsdvvpasdaekyrq

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >4d1lB (B:)
ggseeiftlqvrgreryeilkklndslelsdvvpasdaekyrqkfmtk

    Sequence, based on observed residues (ATOM records): (download) 
    >4d1lB (B:)
eiftlqvrgreryeilkklndslelsdvvpasdaeky

  • Chain 'C':
    Sequence, based on SEQRES records: (download) 
    >4d1lC (C:)
ggseeiftlqvrgreryeilkklndslelsdvvpasdaekyrqkfmtk

    Sequence, based on observed residues (ATOM records): (download) 
    >4d1lC (C:)
eeiftlqvrgreryeilkklndslelsdvvpasdaekyrq

  • Chain 'D':
    Sequence, based on SEQRES records: (download) 
    >4d1lD (D:)
ggseeiftlqvrgreryeilkklndslelsdvvpasdaekyrqkfmtk

    Sequence, based on observed residues (ATOM records): (download) 
    >4d1lD (D:)
eeiftlqvrgreryeilkklndslelsdvvpasdaekyrqk

  • Chain 'E':
    Sequence, based on SEQRES records: (download) 
    >4d1lE (E:)
ggseeiftlqvrgreryeilkklndslelsdvvpasdaekyrqkfmtk

    Sequence, based on observed residues (ATOM records): (download) 
    >4d1lE (E:)
eiftlqvrgreryeilkklndslelsdvvpasdaekyrqkf

  • Chain 'F':
    Sequence, based on SEQRES records: (download) 
    >4d1lF (F:)
ggseeiftlqvrgreryeilkklndslelsdvvpasdaekyrqkfmtk

    Sequence, based on observed residues (ATOM records): (download) 
    >4d1lF (F:)
eeiftlqvrgreryeilkklndslelsdvvpasdaekyr