PDB entry 4d0s

View 4d0s on RCSB PDB site
Description: Mtb InhA complex with Pyradizinone compound 14
Class: oxidoreductase
Keywords: oxidoreductase, inha, acp enoyl reductase, methyl-thiazole
Deposited on 2014-04-29, released 2015-05-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-05-20, with a file datestamp of 2015-05-15.
Experiment type: XRAY
Resolution: 1.64 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH]
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4d0sa_
  • Chain 'B':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH]
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4d0sb_
  • Chain 'C':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH]
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4d0sc_
  • Chain 'D':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH]
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4d0sd_
  • Heterogens: NAD, 9G4, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4d0sA (A:)
    mtglldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpakapl
    leldvqneehlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvskgi
    hisaysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvareag
    kygvrsnlvaagpirtlamsaivggalgeeagaqiqlleegwdqrapigwnmkdatpvak
    tvcallsdwlpattgdiiyadggahtqll
    

    Sequence, based on observed residues (ATOM records): (download)
    >4d0sA (A:)
    glldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrliqritdrlpakaplleld
    vqneehlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvskgihisa
    ysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvareagkygv
    rsnlvaagpirtalgeeagaqiqlleegwdqrapigwnmkdatpvaktvcallsdwlpat
    tgdiiyadggahtqll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4d0sB (B:)
    mtglldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpakapl
    leldvqneehlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvskgi
    hisaysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvareag
    kygvrsnlvaagpirtlamsaivggalgeeagaqiqlleegwdqrapigwnmkdatpvak
    tvcallsdwlpattgdiiyadggahtqll
    

    Sequence, based on observed residues (ATOM records): (download)
    >4d0sB (B:)
    tglldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpakapll
    eldvqneehlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvskgih
    isaysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvareagk
    ygvrsnlvaagpirtaqiqlleegwdqrapigwnmkdatpvaktvcallsdwlpattgdi
    iyadggahtqll
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4d0sC (C:)
    mtglldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpakapl
    leldvqneehlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvskgi
    hisaysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvareag
    kygvrsnlvaagpirtlamsaivggalgeeagaqiqlleegwdqrapigwnmkdatpvak
    tvcallsdwlpattgdiiyadggahtqll
    

    Sequence, based on observed residues (ATOM records): (download)
    >4d0sC (C:)
    tglldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpakapll
    eldvqneehlaslagrvteaigagnkldgvvhsigfmpqtgmgnpffdapyadvskgihi
    saysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvareagky
    gvrsnlvaagpirtleagaqiqlleegwdqrapigwnmkdatpvaktvcallsdwlpatt
    gdiiyadggahtqll
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4d0sD (D:)
    mtglldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpakapl
    leldvqneehlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvskgi
    hisaysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvareag
    kygvrsnlvaagpirtlamsaivggalgeeagaqiqlleegwdqrapigwnmkdatpvak
    tvcallsdwlpattgdiiyadggahtqll
    

    Sequence, based on observed residues (ATOM records): (download)
    >4d0sD (D:)
    glldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpakaplle
    ldvqneehlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvskgihi
    saysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvareagky
    gvrsnlvaagpirtgalgeeagaqiqlleegwdqrapigwnmkdatpvaktvcallsdwl
    pattgdiiyadggahtqll