PDB entry 4d0l

View 4d0l on RCSB PDB site
Description: Phosphatidylinositol 4-kinase III beta-PIK93 in a complex with Rab11a- GTP gammaS
Class: transferase/hydrolase
Keywords: transferase-hydrolase complex, transferase, phosphatidylinositol 4-kinase, pi4k, nucleotide, GTP, rab11, pik93, signaling, gtpase, signal transduction, golgi, recycling endosome, pi4p, phosphoinositide, ptdins4p, pi4kb
Deposited on 2014-04-29, released 2014-05-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-06-11, with a file datestamp of 2014-06-06.
Experiment type: XRAY
Resolution: 2.94 Å
R-factor: 0.21843
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphatidylinositol 4-kinase beta
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Ras-related protein Rab-11A
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62491
      • engineered mutation (72)
    Domains in SCOPe 2.06: d4d0lb_
  • Chain 'C':
    Compound: phosphatidylinositol 4-kinase beta
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Ras-related protein Rab-11A
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62491
      • engineered mutation (72)
    Domains in SCOPe 2.06: d4d0ld_
  • Chain 'E':
    Compound: phosphatidylinositol 4-kinase beta
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Ras-related protein Rab-11A
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62491
      • engineered mutation (72)
    Domains in SCOPe 2.06: d4d0lf_
  • Heterogens: 093, GSP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4d0lB (B:)
    gshmgtrddeydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdg
    ktikaqiwdtagleryraitsayyrgavgallvydiakhltyenverwlkelrdhadsni
    vimlvgnksdlrhlravptdearafaeknglsfietsaldstnveaafqtilteiyrivs
    qkqmsdrrendmspsnnvvpihvppttenkpkvqccqni
    

    Sequence, based on observed residues (ATOM records): (download)
    >4d0lB (B:)
    deydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgktikaqiw
    dtagleryraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivimlvgnk
    sdlrhlravptdearafaeknglsfietsaldstnveaafqtilteiyrivsq
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4d0lD (D:)
    gshmgtrddeydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdg
    ktikaqiwdtagleryraitsayyrgavgallvydiakhltyenverwlkelrdhadsni
    vimlvgnksdlrhlravptdearafaeknglsfietsaldstnveaafqtilteiyrivs
    qkqmsdrrendmspsnnvvpihvppttenkpkvqccqni
    

    Sequence, based on observed residues (ATOM records): (download)
    >4d0lD (D:)
    deydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgktikaqiw
    dtagleryraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivimlvgnk
    sdlrhlravptdearafaeknglsfietsaldstnveaafqtilteiyrivsqkqms
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4d0lF (F:)
    gshmgtrddeydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdg
    ktikaqiwdtagleryraitsayyrgavgallvydiakhltyenverwlkelrdhadsni
    vimlvgnksdlrhlravptdearafaeknglsfietsaldstnveaafqtilteiyrivs
    qkqmsdrrendmspsnnvvpihvppttenkpkvqccqni
    

    Sequence, based on observed residues (ATOM records): (download)
    >4d0lF (F:)
    deydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgktikaqiw
    dtagleryraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivimlvgnk
    sdlrhlravptdearafaeknglsfietsaldstnveaafqtilteiyrivsqkqms