PDB entry 4d0f

View 4d0f on RCSB PDB site
Description: Human Notch1 EGF domains 11-13 mutant T466A
Class: transcription
Keywords: transcription, metal-binding, transmembrane, developmental, protein, notch signaling pathway, differentiation, phosphorylation, egf-like domain, regulation, receptor, activator, ank repeat, signalling, glycoprotein, extracellular, jagged, nucleus, membrane
Deposited on 2014-04-25, released 2014-05-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-02-07, with a file datestamp of 2018-02-02.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Neurogenic locus notch homolog protein 1
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P46531 (2-117)
    • expression tag (1)
    • expression tag (118-125)
    • engineered mutation (57)
  Domains in SCOPe 2.08: d4d0fa1, d4d0fa2, d4d0fa3, d4d0fa4, d4d0fa5
• Heterogens: CA, EDO, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >4d0fA (A:)
  saqdvdecslganpcehagkcintlgsfecqclqgytgprceidvnecvsnpcqndaacl
  dqigefqcicmpgyegvhcevntdecasspclhngrcldkinefqcecptgftghlcqvd
  lhhildaqkmvwnhr
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >4d0fA (A:)
  aqdvdecslganpcehagkcintlgsfecqclqgytgprceidvnecvsnpcqndaacld
  qigefqcicmpgyegvhcevntdecasspclhngrcldkinefqcecptgftghlcqvdl
  hhild