PDB entry 4d0e

View 4d0e on RCSB PDB site
Description: Human Notch1 EGF domains 11-13 mutant GlcNAc-fucose disaccharide modified at T466
Class: transcription
Keywords: transcription, metal-binding, transmembrane, developmental, notch signaling pathway, differentiation, phosphorylation, egf-like domain, regulation, receptor, activator, ank repeat, signalling, glycoprotein, extracellular, jagged, nucleus, membrane
Deposited on 2014-04-25, released 2014-05-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.61 Å
R-factor: N/A
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neurogenic locus notch homolog protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P46531 (Start-117)
      • expression tag (118-124)
    Domains in SCOPe 2.08: d4d0ea1, d4d0ea2, d4d0ea3, d4d0ea4
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4d0eA (A:)
    saqdvdecslganpcehagkcintlgsfecqclqgytgprceidvnecvsnpcqndatcl
    dqigefqcicmpgyegvhcevntdecasspclhngrcldkinefqcecptgftghlcqvd
    lhhildaqkmvwnhr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4d0eA (A:)
    dvdecslganpcehagkcintlgsfecqclqgytgprceidvnecvsnpcqndatcldqi
    gefqcicmpgyegvhcevntdecasspclhngrcldkinefqcecptgftghlcqvdlhh
    il