PDB entry 4d08

View 4d08 on RCSB PDB site
Description: PDE2a catalytic domain in complex with a brain penetrant inhibitor
Class: hydrolase
Keywords: hydrolase, binding sites, catalytic domain, cyclic nucleotide phosphodiesterases, type 2, type 4, disease models, animal, drug evaluation, preclinical, phosphodiesterase 2 inhibitors, phosphodiesterase inhibitors, protein binding, structure-activity relationship
Deposited on 2014-04-24, released 2014-08-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-09-24, with a file datestamp of 2014-09-19.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.21464
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cgmp-dependent 3', 5'-cyclic phosphodiesterase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4d08a_
  • Chain 'B':
    Compound: cgmp-dependent 3', 5'-cyclic phosphodiesterase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4d08b_
  • Chain 'C':
    Compound: cgmp-dependent 3', 5'-cyclic phosphodiesterase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4d08c_
  • Chain 'D':
    Compound: cgmp-dependent 3', 5'-cyclic phosphodiesterase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4d08d1
  • Heterogens: ZN, Q2T, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4d08A (A:)
    mgsddeytkllhdgiqpvaaidsnfasftytprslpeddtsmailsmlqdmnfinnykid
    cptlarfclmvkkgyrdppyhnwmhafsvshfcyllyknleltnyledieifalfiscmc
    hdldhrgtnnsfqvasksvlaalyssegsvmerhhfaqaiailnthgcnifdhfsrkdyq
    rmldlmrdiilatdlahhlrifkdlqkmaevgydrnnkqhhrlllcllmtscdlsdqtkg
    wkttrkiaeliykeffsqgdlekamgnrpmemmdrekayipelqisfmehiampiykllq
    dlfpkaaelyervasnrehwtkvshkftirglpsnnsldfldeeyerhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4d08A (A:)
    ddeytkllhdgiqpvaaidsnfasftytprslpeddtsmailsmlqdmnfinnykidcpt
    larfclmvkkgyrdppyhnwmhafsvshfcyllyknleltnyledieifalfiscmchdl
    dhrgtnnsfqvasksvlaalyssegsvmerhhfaqaiailnthgcnifdhfsrkdyqrml
    dlmrdiilatdlahhlrifkdlqkmaevgydrnnkqhhrlllcllmtscdlsdqtkgwkt
    trkiaeliykeffsqgdlekamgnrpmemmdrekayipelqisfmehiampiykllqdlf
    pkaaelyervasnrehwtkvshkftirglpsnnsldfld
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4d08B (B:)
    mgsddeytkllhdgiqpvaaidsnfasftytprslpeddtsmailsmlqdmnfinnykid
    cptlarfclmvkkgyrdppyhnwmhafsvshfcyllyknleltnyledieifalfiscmc
    hdldhrgtnnsfqvasksvlaalyssegsvmerhhfaqaiailnthgcnifdhfsrkdyq
    rmldlmrdiilatdlahhlrifkdlqkmaevgydrnnkqhhrlllcllmtscdlsdqtkg
    wkttrkiaeliykeffsqgdlekamgnrpmemmdrekayipelqisfmehiampiykllq
    dlfpkaaelyervasnrehwtkvshkftirglpsnnsldfldeeyerhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4d08B (B:)
    deytkllhdgiqpvaaidsnfasftytprslpeddtsmailsmlqdmnfinnykidcptl
    arfclmvkkgyrdppyhnwmhafsvshfcyllyknleltnyledieifalfiscmchdld
    hrgtnnsfqvasksvlaalyssegsvmerhhfaqaiailnthgcnifdhfsrkdyqrmld
    lmrdiilatdlahhlrifkdlqkmaevgydrnnkqhhrlllcllmtscdlsdqtkgwktt
    rkiaeliykeffsqgdlekamgnrpmemmdrekayipelqisfmehiampiykllqdlfp
    kaaelyervasnrehwtkvshkftirglpsnnsldfl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4d08C (C:)
    mgsddeytkllhdgiqpvaaidsnfasftytprslpeddtsmailsmlqdmnfinnykid
    cptlarfclmvkkgyrdppyhnwmhafsvshfcyllyknleltnyledieifalfiscmc
    hdldhrgtnnsfqvasksvlaalyssegsvmerhhfaqaiailnthgcnifdhfsrkdyq
    rmldlmrdiilatdlahhlrifkdlqkmaevgydrnnkqhhrlllcllmtscdlsdqtkg
    wkttrkiaeliykeffsqgdlekamgnrpmemmdrekayipelqisfmehiampiykllq
    dlfpkaaelyervasnrehwtkvshkftirglpsnnsldfldeeyerhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4d08C (C:)
    iqpvaaidsnfasftytprslpeddtsmailsmlqdmnfinnykidcptlarfclmvkkg
    yrdppyhnwmhafsvshfcyllyknleltnyledieifalfiscmchdldhrgtnnsfqv
    asksvlaalyssegsvmerhhfaqaiailnthgcnifdhfsrkdyqrmldlmrdiilatd
    lahhlrifkdlqkmaevgydrnnkqhhrlllcllmtscdlsdqtkgwkttrkiaeliyke
    ffsqgdlekamgnrpmemmdrekayipelqisfmehiampiykllqdlfpkaaelyerva
    snrehwtkvshkftirglpsnnsldfl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4d08D (D:)
    mgsddeytkllhdgiqpvaaidsnfasftytprslpeddtsmailsmlqdmnfinnykid
    cptlarfclmvkkgyrdppyhnwmhafsvshfcyllyknleltnyledieifalfiscmc
    hdldhrgtnnsfqvasksvlaalyssegsvmerhhfaqaiailnthgcnifdhfsrkdyq
    rmldlmrdiilatdlahhlrifkdlqkmaevgydrnnkqhhrlllcllmtscdlsdqtkg
    wkttrkiaeliykeffsqgdlekamgnrpmemmdrekayipelqisfmehiampiykllq
    dlfpkaaelyervasnrehwtkvshkftirglpsnnsldfldeeyerhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4d08D (D:)
    klliqpvaaidsnfasftytprslpeddtsmailsmlqdmnfinnykidcptlarfclmv
    kkgyrdppyhnwmhafsvshfcyllyknleltnyledieifalfiscmchdldhrgtnns
    fqvasksvlaalyssegsvmerhhfaqaiailnthgcnifdhfsrkdyqrmldlmrdiil
    atdlahhlrifkdlqkmaevgydrnnkqhhrlllcllmtscdlsdqtkgwkttrkiaeli
    ykeffsqgdlekamgnrpmemmdrekayipelqisfmehiampiykllqdlfpkaaelye
    rvasnrehwtkvshkftirglpsnnsldfldeeye